IL-3 Protein, Mouse (HEK293, Fc)
Based on 1 Customer Validation
IL-3 protein is secreted by T lymphocytes, mast cells and osteoblasts.It plays an important regulatory role in hematopoietic progenitor cells and stimulates mature basophils, eosinophils and monocytes.In addition to hematopoiesis, it supports neuronal cell proliferation, survival, and bone homeostasis by inhibiting osteoclast differentiation.IL-3 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IL-3 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
IL-3 protein is secreted by T lymphocytes, mast cells and osteoblasts.It plays an important regulatory role in hematopoietic progenitor cells and stimulates mature basophils, eosinophils and monocytes.In addition to hematopoiesis, it supports neuronal cell proliferation, survival, and bone homeostasis by inhibiting osteoclast differentiation.IL-3 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IL-3 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
The cytokine IL-3, predominantly secreted by activated T-lymphocytes, mast cells, and osteoblastic cells, plays a crucial role in controlling the production and differentiation of hematopoietic progenitor cells into lineage-restricted cells. Moreover, IL-3 stimulates mature basophils, eosinophils, and monocytes, promoting their functional activation. Beyond its hematopoietic functions, IL-3 contributes to neural cell proliferation and survival and participates in bone homeostasis by inhibiting osteoclast differentiation through the prevention of NF-kappa-B nuclear translocation and activation. Mechanistically, IL-3 exerts its biological effects through a receptor composed of the IL3RA subunit and a signal transducing subunit IL3RB, leading to the rapid activation of JAK2 kinase activity and subsequent STAT5-mediated transcriptional programming. Additionally, IL-3, as a monomer, contributes to cell survival under oxidative stress in non-hematopoietic systems by activating pathways mediated by PI3K/AKT and ERK.
Verified Bioactivity
Loaded Mouse IL-3, hFc Tag on ProA-Biosensor can bind Mouse IL-3 R alpha, His Tag with an affinity constant of ≤2.23 µM as determined in BLI assay.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-hFc
-
Accession
P01586 (A27-C166)
-
Molecular Construction
-
N-term
-
IL-3 (A27-C166)
Accession # P01586 -
hFc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IL3; Colony-Stimulating Factor, Multiple; Interleukin 3; P-Cell Stimulating Factor; IL-3; P-Cell-Stimulating Factor; Hematopoietic Growth Factor; Mast-Cell Growth Factor; MCGF; Mast Cell Growth Factor; Multipotential Colony-Stimulating Factor; MGC79398; I
-
AA Sequence
ASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC
-
Predicted Molecular Mass
42.2 kDa
-
Molecular Weight
Approximately 55-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.
<0.005 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
