Copy Link Print Information

IL-4 Protein, Cynomolgus (HEK293, His)

Customer Review

Based on 1 Customer Validation

IL-4 protein has an important effect on B cell activation, acting as a costimulator for DNA synthesis and promoting the expression of class II MHC molecules on resting B cells. It enhances IgE and IgG1 secretion and cell surface expression while also regulating CD23 expression on lymphocytes and monocytes. IL-4 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived IL-4 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Cynomolgus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • IL-4 Protein, Cynomolgus (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

IL-4 protein has an important effect on B cell activation, acting as a costimulator for DNA synthesis and promoting the expression of class II MHC molecules on resting B cells. It enhances IgE and IgG1 secretion and cell surface expression while also regulating CD23 expression on lymphocytes and monocytes. IL-4 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived IL-4 protein, expressed by HEK293 , with C-His labeled tag.

Background

IL-4 protein plays a pivotal role in various B-cell activation processes and other cell types, acting as a costimulator for DNA synthesis. Additionally, it promotes the expression of class II MHC molecules on resting B-cells and enhances the secretion and cell surface expression of both IgE and IgG1. IL-4 also regulates the expression of CD23, the low affinity Fc receptor for IgE, on lymphocytes and monocytes. Furthermore, it positively regulates IL31RA expression in macrophages and stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and inducing RUFY4.

Verified Bioactivity

1. Cynomolgus IL-4, His Tag immobilized on CM5 Chip can bind Cynomolgus IL-4 R alpha, His Tag with an affinity constant of 13.48 nM as determined in SPR assay (Biacore T200).
2. Immobilized Cynomolgus IL-4, His Tag at 2μg/ml (100μl/well) on the plate. Dose response curve for Human IL-4 R alpha, hFc Tag with the EC50 of ≤1.2 ng/ml determined by ELISA.

Technical Parameters

  • Species Cynomolgus
  • Source HEK293
  • Tag C-8*His
  • Accession

    P79339-1 (H25-S153)

  • Gene ID
    107130068  [NCBI]
  • Molecular Construction
    • N-term
    • IL-4 (H25-S153)
      Accession # P79339-1
    • 8*His
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    IL4; B_cell Stimulatory Factor 1; Interleukin 4; B-Cell Stimulatory Factor 1; IL-4; B Cell Growth Factor 1; Lymphocyte Stimulatory Factor 1; Binetrakin; Interleukin-4; Pitrakinra; BCGF-1; MGC79402; BCGF1; BSF-1; BSF1

  • AA Sequence

    HKCDITLQEIIKTLNSLTEQKTLCTKLTITDILAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS

  • Predicted Molecular Mass

    16 kDa

  • Molecular Weight

    Approximately 20-28 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • IL-4 Protein, Cynomolgus (HEK293, His) Product Image
    1/16
  • IL-4 Protein, Cynomolgus (HEK293, His) Product Image