IL-4 Protein, Cynomolgus (HEK293, His)

IL-4 protein has an important effect on B cell activation, acting as a costimulator for DNA synthesis and promoting the expression of class II MHC molecules on resting B cells. It enhances IgE and IgG1 secretion and cell surface expression while also regulating CD23 expression on lymphocytes and monocytes. IL-4 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived IL-4 protein, expressed by HEK293 , with C-His labeled tag.

IL-4 protein plays a pivotal role in various B-cell activation processes and other cell types, acting as a costimulator for DNA synthesis. Additionally, it promotes the expression of class II MHC molecules on resting B-cells and enhances the secretion and cell surface expression of both IgE and IgG1. IL-4 also regulates the expression of CD23, the low affinity Fc receptor for IgE, on lymphocytes and monocytes. Furthermore, it positively regulates IL31RA expression in macrophages and stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and inducing RUFY4.

1. Cynomolgus IL-4, His Tag immobilized on CM5 Chip can bind Cynomolgus IL-4 R alpha, His Tag with an affinity constant of 13.48 nM as determined in SPR assay (Biacore T200).
2. Immobilized Cynomolgus IL-4, His Tag at 2μg/ml (100μl/well) on the plate. Dose response curve for Human IL-4 R alpha, hFc Tag with the EC₅₀ of ≤1.2 ng/ml determined by ELISA.

Cynomolgus

HEK293

C-8*His

P79339-1 (H25-S153)

107130068  [NCBI]

Full Length of Isoform-1 Mature Protein

HKCDITLQEIIKTLNSLTEQKTLCTKLTITDILAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS

Approximately 20-28 kDa, based on Bis-Tris PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.