1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins Pseudokinases TKL
  4. IRAK
  5. IRAK4 Protein, Human (Active, 307a.a, sf9, His)

IRAK4 Protein, Human (Active, 307a.a, sf9, His)

Cat. No.: HY-P702732
Handling Instructions Technical Support

The IRAK4 protein is a serine/threonine protein kinase that is critical for initiating the innate immune response through the Toll-like receptor (TLR) and IL-1R signaling pathways. After TLR is activated, it rapidly forms the Myddosome with IRAK2. IRAK4 Protein, Human (307a.a, sf9, His) is the recombinant human-derived IRAK4, expressed by Sf9 insect cells, with His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The IRAK4 protein is a serine/threonine protein kinase that is critical for initiating the innate immune response through the Toll-like receptor (TLR) and IL-1R signaling pathways. After TLR is activated, it rapidly forms the Myddosome with IRAK2. IRAK4 Protein, Human (307a.a, sf9, His) is the recombinant human-derived IRAK4, expressed by Sf9 insect cells, with His labeled tag.

Background

The IRAK4 protein functions as a pivotal serine/threonine-protein kinase, playing a crucial role in initiating the innate immune response against foreign pathogens. It is actively involved in Toll-like receptor (TLR) and IL-1R signaling pathways, and upon TLR activation, it is rapidly recruited by MYD88 to form the Myddosome in conjunction with IRAK2. Initially, IRAK1 is phosphorylated, stimulating its kinase activity and inducing intensive autophosphorylation. Additionally, IRAK4 phosphorylates E3 ubiquitin ligases Pellino proteins (PELI1, PELI2, and PELI3), facilitating pellino-mediated polyubiquitination of IRAK1. Consequently, the polyubiquitinated IRAK1 binds with the ubiquitin-binding domain of IKBKG/NEMO, assembling the IRAK1-MAP3K7/TAK1-TRAF6 complex and the NEMO-IKKA-IKKB complex. This, in turn, activates IKKs (CHUK/IKKA and IKBKB/IKKB), leading to nuclear translocation and activation of NF-kappa-B. Alternatively, TIRAP is phosphorylated by IRAK4, promoting its ubiquitination and subsequent degradation. Moreover, IRAK4 phosphorylates NCF1, which regulates NADPH oxidase activation following LPS stimulation, suggesting a similar mechanism during microbial infections.

Species

Human

Source

Sf9 insect cells

Tag

His

Accession

Q9NWZ3-1 (E154-S460)

Gene ID

51135

Protein Length

Partial

Synonyms
Interleukin-1 receptor-associated kinase 4; IPD1; IRAK4; NY-REN-64; REN64
AA Sequence

ENKSLEVSDTRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS

Purity

≥ 80%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

IRAK4 Protein, Human (Active, 307a.a, sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IRAK4 Protein, Human (Active, 307a.a, sf9, His)
Cat. No.:
HY-P702732
Quantity:
MCE Japan Authorized Agent: