IRAK4 Protein, Human (Active, 307a.a, sf9, His)

The IRAK4 protein is a serine/threonine protein kinase that is critical for initiating the innate immune response through the Toll-like receptor (TLR) and IL-1R signaling pathways. After TLR is activated, it rapidly forms the Myddosome with IRAK2. IRAK4 Protein, Human (307a.a, sf9, His) is the recombinant human-derived IRAK4, expressed by Sf9 insect cells, with His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The IRAK4 protein is a serine/threonine protein kinase that is critical for initiating the innate immune response through the Toll-like receptor (TLR) and IL-1R signaling pathways. After TLR is activated, it rapidly forms the Myddosome with IRAK2. IRAK4 Protein, Human (307a.a, sf9, His) is the recombinant human-derived IRAK4, expressed by Sf9 insect cells, with His labeled tag.

Background

The IRAK4 protein functions as a pivotal serine/threonine-protein kinase, playing a crucial role in initiating the innate immune response against foreign pathogens. It is actively involved in Toll-like receptor (TLR) and IL-1R signaling pathways, and upon TLR activation, it is rapidly recruited by MYD88 to form the Myddosome in conjunction with IRAK2. Initially, IRAK1 is phosphorylated, stimulating its kinase activity and inducing intensive autophosphorylation. Additionally, IRAK4 phosphorylates E3 ubiquitin ligases Pellino proteins (PELI1, PELI2, and PELI3), facilitating pellino-mediated polyubiquitination of IRAK1. Consequently, the polyubiquitinated IRAK1 binds with the ubiquitin-binding domain of IKBKG/NEMO, assembling the IRAK1-MAP3K7/TAK1-TRAF6 complex and the NEMO-IKKA-IKKB complex. This, in turn, activates IKKs (CHUK/IKKA and IKBKB/IKKB), leading to nuclear translocation and activation of NF-kappa-B. Alternatively, TIRAP is phosphorylated by IRAK4, promoting its ubiquitination and subsequent degradation. Moreover, IRAK4 phosphorylates NCF1, which regulates NADPH oxidase activation following LPS stimulation, suggesting a similar mechanism during microbial infections.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag His
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Synonyms

    IRAK4; Interleukin-1 Receptor Associated Kinase 4 Mutant Form 2; Interleukin 1 Receptor Associated Kinase 4; Interleukin-1 Receptor-Associated Kinase 4 Isoform 2; Interleukin-1 Receptor-Associated Kinase 4; Non-Specific Serine/Threonine Protein Kinase; NY

  • AA Sequence

    ENKSLEVSDTRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS

  • Purity

    ≥ 80%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00