Irisin Protein, Human/Mouse/Rat (HEK293, N-His)

Irisin is a hormone derived from the FNDC5 gene that promotes energy expenditure via thermogenesis. Irisin Protein, Human/Mouse/Rat (HEK293, N-His) is the recombinant human, rat, mouse-derived Irisin protein, expressed by HEK293 , with N-6*His labeled tag.

Irisin is a hormone found to be derived from the fibronectin type III domain (FNDC5) gene, which is primarily released from skeletal muscle following exercise or exposure to cold. Irisin is primarily secreted by muscle and increases with exercise. In particular, irisin has been shown to have beneficial effects on adipose tissue, brain, and bone^[1]. Recombinant human/mouse/rat irisin protein (20-200 ng/ml; 24 h) had no effect on E-selectin expression at low concentrations. When HUVECs were treated with high concentrations of irisin (200 ng/ml), soluble E-selectin concentrations were similar to levels detected in controls treated with regular growth medium^[2].

Measured by its ability to induce p38 MAPK activation in 3T3 L1 mouse embryonic fibroblast adipose-like cells. 1 μg/mL of Recombinant Human Irisin can effectively induce p38 MAPK activation.

Human; Rat; Mouse

HEK293

N-6*His

A0A0A0MRR6 (D32-E143)

252995  [NCBI]

Partial

DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE

Approximately 18-30 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Hyeonwoo Kim, et al. Irisin Mediates Effects on Bone and Fat via αV Integrin Receptors. Cell.  [Content Brief]

  [2]. Karan S Rana, et al. Plasma irisin is elevated in type 2 diabetes and is associated with increased E-selectin levels. Cardiovasc Diabetol.  [Content Brief]