Copy Link Print Information

Irisin Protein, Human/Mouse/Rat (HEK293, N-His)

4 Cited Publications
Customer Review

Based on 4 publication(s) in Google Scholar

Irisin is a hormone derived from the FNDC5 gene that promotes energy expenditure via thermogenesis. Irisin Protein, Human/Mouse/Rat (HEK293, N-His) is the recombinant human, rat, mouse-derived Irisin protein, expressed by HEK293 , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human; Rat; Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Irisin Protein, Human/Mouse/Rat (HEK293, N-His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Irisin is a hormone derived from the FNDC5 gene that promotes energy expenditure via thermogenesis. Irisin Protein, Human/Mouse/Rat (HEK293, N-His) is the recombinant human, rat, mouse-derived Irisin protein, expressed by HEK293 , with N-6*His labeled tag.

Background

Irisin is a hormone found to be derived from the fibronectin type III domain (FNDC5) gene, which is primarily released from skeletal muscle following exercise or exposure to cold. Irisin is primarily secreted by muscle and increases with exercise. In particular, irisin has been shown to have beneficial effects on adipose tissue, brain, and bone[1]. Recombinant human/mouse/rat irisin protein (20-200 ng/ml; 24 h) had no effect on E-selectin expression at low concentrations. When HUVECs were treated with high concentrations of irisin (200 ng/ml), soluble E-selectin concentrations were similar to levels detected in controls treated with regular growth medium[2].

Verified Bioactivity

Measured by its ability to induce p38 MAPK activation in 3T3 L1 mouse embryonic fibroblast adipose-like cells. 1 μg/mL of Recombinant Human Irisin can effectively induce p38 MAPK activation.

Technical Parameters

  • Species Human; Rat; Mouse
  • Source HEK293
  • Tag N-6*His
  • Accession

    A0A0A0MRR6 (D32-E143)

  • Gene ID
    252995  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His
    • Irisin (D32-E143)
      Accession # A0A0A0MRR6
    • C-term
  • Protein Length

    Partial

  • Synonyms

    FNDC5; Fibronectin Type III Domain-Containing Protein 5; Fibronectin Type III Domain Containing 5; Fibronectin Type III Repeat-Containing Protein 2; FRCP2; Irisin

  • AA Sequence

    DSPSAPVNVTVRHLKANSAVVSWDVLEDEVVIGFAISQQKKDVRMLRFIQEVNTTTRSCALWDLEEDTEYIVHVQAISIQGQSPASEPVLFKTPREAEKMASKNKDEVTMKE

  • Predicted Molecular Mass

    12.6 kDa

  • Molecular Weight

    Approximately 18-28 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS.
3.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

[1]. Hyeonwoo Kim, et al. Irisin Mediates Effects on Bone and Fat via αV Integrin Receptors. Cell. [Content Brief]

[2]. Karan S Rana, et al. Plasma irisin is elevated in type 2 diabetes and is associated with increased E-selectin levels. Cardiovasc Diabetol. [Content Brief]

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • Irisin Protein, Human/Mouse/Rat (HEK293, N-His) Product Image
    1/16
  • Irisin Protein, Human/Mouse/Rat (HEK293, N-His) Product Image