1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. KDM8 Protein, Human

The KDM8 protein is a multifunctional enzyme that acts as an endopeptidase and 2-oxoglutarate-dependent monooxygenase. As an endopeptidase, it cleaves histone tails at methylated arginine or lysine residues, producing "tailless nucleosomes" that facilitate transcription elongation. KDM8 Protein, Human is the recombinant human-derived KDM8 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The KDM8 protein is a multifunctional enzyme that acts as an endopeptidase and 2-oxoglutarate-dependent monooxygenase. As an endopeptidase, it cleaves histone tails at methylated arginine or lysine residues, producing "tailless nucleosomes" that facilitate transcription elongation. KDM8 Protein, Human is the recombinant human-derived KDM8 protein, expressed by E. coli , with tag free.

Background

The KDM8 protein is a multifunctional enzyme acting both as an endopeptidase and a 2-oxoglutarate-dependent monooxygenase. As an endopeptidase, it cleaves histone N-terminal tails at the carboxyl side of methylated arginine or lysine residues, generating 'tailless nucleosomes' that may trigger transcription elongation. This function is evident in its preference for cleaving monomethylated and dimethylated arginine residues of histones H2, H3, and H4, with subsequent digestion of histone tails through its aminopeptidase activity. In response to DNA damage, KDM8 targets the N-terminal tail of histone H3 at monomethylated lysine residues, particularly at 'Lys-9' (H3K9me1), with a major focus on the histone variant H3F3A. Additionally, KDM8 functions as a Fe(2+) and 2-oxoglutarate-dependent monooxygenase, catalyzing (R)-stereospecific hydroxylation at C-3 of 'Arg-137' of RPS6 and 'Arg-141' of RCCD1, though the biological significance of this activity is yet to be fully elucidated. It regulates mitosis by participating in the transcriptional repression of satellite repeats and potentially influencing H3K36 methylation in centromeric regions along with RCCD1. Together with RCCD1, it contributes to proper mitotic spindle organization and chromosome segregation. KDM8 also negatively regulates the cell cycle repressor CDKN1A/p21, required for G2/M phase cell cycle progression, and regulates the expression of CCNA1/cyclin-A1, impacting cancer cell proliferation. Furthermore, it plays a role in regulating alpha-tubulin acetylation and cytoskeletal microtubule stability involved in epithelial to mesenchymal transition. Additionally, KDM8 is involved in regulating circadian gene expression in the liver, repressing the transcriptional activator activity of the CLOCK-BMAL1 heterodimer, and negatively regulating the protein stability and function of CRY1, thereby contributing to AMPK-FBXL3-induced CRY1 degradation.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

Q8N371 (T183-S416)

Gene ID

79831

Molecular Construction
N-term
KDM8 (T183-S416)
Accession # Q8N371
C-term
Protein Length

Partial

Synonyms
KDM8; Bifunctional peptidase and arginyl-hydroxylase JMJD5; JmjC domain-containing protein 5; Jumonji C domain-containing protein 5; L-arginine (3R)-hydroxylase KDM8
AA Sequence

TVPRLHRPSLQHFREQFLVPGRPVILKGVADHWPCMQKWSLEYIQEIAGCRTVPVEVGSRYTDEEWSQTLMTVNEFISKYIVNEPRDVGYLAQHQLFDQIPELKQDISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKYIRLYSPQESGALYPHDTHLLHNTSQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYWHYVRALDLSFSVSFWWS

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

KDM8 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

KDM8 Protein, Human

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
KDM8 Protein, Human
Cat. No.:
HY-P701623
Quantity:
MCE Japan Authorized Agent: