KDM8 Protein, Human

The KDM8 protein is a multifunctional enzyme that acts as an endopeptidase and 2-oxoglutarate-dependent monooxygenase. As an endopeptidase, it cleaves histone tails at methylated arginine or lysine residues, producing "tailless nucleosomes" that facilitate transcription elongation. KDM8 Protein, Human is the recombinant human-derived KDM8 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The KDM8 protein is a multifunctional enzyme that acts as an endopeptidase and 2-oxoglutarate-dependent monooxygenase. As an endopeptidase, it cleaves histone tails at methylated arginine or lysine residues, producing "tailless nucleosomes" that facilitate transcription elongation. KDM8 Protein, Human is the recombinant human-derived KDM8 protein, expressed by E. coli , with tag free.

Background

The KDM8 protein is a multifunctional enzyme acting both as an endopeptidase and a 2-oxoglutarate-dependent monooxygenase. As an endopeptidase, it cleaves histone N-terminal tails at the carboxyl side of methylated arginine or lysine residues, generating 'tailless nucleosomes' that may trigger transcription elongation. This function is evident in its preference for cleaving monomethylated and dimethylated arginine residues of histones H2, H3, and H4, with subsequent digestion of histone tails through its aminopeptidase activity. In response to DNA damage, KDM8 targets the N-terminal tail of histone H3 at monomethylated lysine residues, particularly at 'Lys-9' (H3K9me1), with a major focus on the histone variant H3F3A. Additionally, KDM8 functions as a Fe(2+) and 2-oxoglutarate-dependent monooxygenase, catalyzing (R)-stereospecific hydroxylation at C-3 of 'Arg-137' of RPS6 and 'Arg-141' of RCCD1, though the biological significance of this activity is yet to be fully elucidated. It regulates mitosis by participating in the transcriptional repression of satellite repeats and potentially influencing H3K36 methylation in centromeric regions along with RCCD1. Together with RCCD1, it contributes to proper mitotic spindle organization and chromosome segregation. KDM8 also negatively regulates the cell cycle repressor CDKN1A/p21, required for G2/M phase cell cycle progression, and regulates the expression of CCNA1/cyclin-A1, impacting cancer cell proliferation. Furthermore, it plays a role in regulating alpha-tubulin acetylation and cytoskeletal microtubule stability involved in epithelial to mesenchymal transition. Additionally, KDM8 is involved in regulating circadian gene expression in the liver, repressing the transcriptional activator activity of the CLOCK-BMAL1 heterodimer, and negatively regulating the protein stability and function of CRY1, thereby contributing to AMPK-FBXL3-induced CRY1 degradation.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • KDM8 (T183-S416)
      Accession # Q8N371
    • C-term
  • Protein Length

    Partial

  • Synonyms

    KDM8; Lysine (K)-Specific Demethylase 8; Prev. JMJD5; JmjC Arginyl-Hydroxylase; Bifunctional Peptidase And Arginyl-Hydroxylase JMJD5; FLJ13798; Jumonji C Domain-Containing Protein 5; Jumonji Domain-Containing Protein 5; L-Arginine (3R)-Hydroxylase KDM8; L

  • AA Sequence

    TVPRLHRPSLQHFREQFLVPGRPVILKGVADHWPCMQKWSLEYIQEIAGCRTVPVEVGSRYTDEEWSQTLMTVNEFISKYIVNEPRDVGYLAQHQLFDQIPELKQDISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKYIRLYSPQESGALYPHDTHLLHNTSQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYWHYVRALDLSFSVSFWWS

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00