Ki67/MKI67 Protein, Human (GST)

Customer Review

Based on 1 Customer Validation

Ki67/MKI67 is localized on mitotic chromosomes and maintains its dispersion during nuclear envelope disassembly. It covers a large portion of the chromosome surface and prevents chromatin from collapsing into clumps. Ki67/MKI67 Protein, Human (GST) is the recombinant human-derived Ki67/MKI67 protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Ki67/MKI67 is localized on mitotic chromosomes and maintains its dispersion during nuclear envelope disassembly. It covers a large portion of the chromosome surface and prevents chromatin from collapsing into clumps. Ki67/MKI67 Protein, Human (GST) is the recombinant human-derived Ki67/MKI67 protein, expressed by E. coli , with N-GST labeled tag.

Background

The Ki67/MKI67 protein is essential for maintaining the dispersion of individual mitotic chromosomes in the cytoplasm following nuclear envelope disassembly. Positioned on the surface of the mitotic chromosome, specifically within the perichromosomal layer, Ki67/MKI67 covers a significant fraction of the chromosome surface, preventing the collapse of chromosomes into a singular chromatin mass. Functioning as a surfactant with a high net electrical charge, it establishes a steric and electrostatic charge barrier, facilitating independent chromosome motility. Ki67/MKI67 exhibits DNA-binding capabilities, displaying a preference for supercoiled DNA and AT-rich DNA. While it does not contribute to the internal structure of mitotic chromosomes, its role in chromatin organization remains uncertain, raising the possibility that this may be an indirect consequence of its primary function in maintaining dispersed mitotic chromosomes. The protein interacts with various partners, including KIF15, NIFK, PPP1CC, and forms part of a complex involving ZNF335, HCFC1, CCAR2, EMSY, RBBP5, ASH2L, and WDR5, suggesting its involvement in intricate cellular processes and molecular networks.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-GST
  • Accession
  • Gene ID
  • Protein Length

    Partial

  • Synonyms

    MKI67; Antigen Ki67; Marker Of Proliferation Ki-67; Ki-67; Antigen Identified By Monoclonal Antibody Ki-67; Proliferation-Related Ki-67 Antigen; PPP1R105; Antigen KI-67; MIB-1; KI67 Antigen; Protein Phosphatase 1, Regulatory Subunit 105; MIB-; Molecular I

  • AA Sequence

    MWPTRRLVTIKRSGVDGPHFPLSLSTCLFGRGIECDIRIQLPVVSKQHCKIEIHEQEAILHNFSSTNPTQVNGSVIDEPVRLKHGDVITIIDRSFRYENESLQNGRKSTEFPRKIREQEP

  • Molecular Weight

    Approximately 37-41 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00