1. Recombinant Proteins
  2. CD Antigens Receptor Proteins Biotinylated Proteins
  3. NK Cell CD Proteins Killer-Cell Immunoglobulin-like Receptors
  4. CD158a/KIR2DL1
  5. KIR2DL1 Protein, Human (Biotinylated, HEK293, His-Avi)

KIR2DL1 Protein, Human (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P78165
Handling Instructions Technical Support

KIR2DL1, found on NK cells, serves as a receptor for specific HLA-C alleles, inhibiting NK cell activity to prevent cell lysis. This regulatory function involves interactions with ARRB2 and, additionally, engages PTPN6 and PTPN11. The interaction's enhancement by ARRB2 underscores KIR2DL1's role in complex signaling networks that modulate NK cell function. KIR2DL1 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived KIR2DL1 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

KIR2DL1, found on NK cells, serves as a receptor for specific HLA-C alleles, inhibiting NK cell activity to prevent cell lysis. This regulatory function involves interactions with ARRB2 and, additionally, engages PTPN6 and PTPN11. The interaction's enhancement by ARRB2 underscores KIR2DL1's role in complex signaling networks that modulate NK cell function. KIR2DL1 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived KIR2DL1 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

KIR2DL1, located on natural killer (NK) cells, acts as a receptor for specific HLA-C alleles, including w4 and w6, ultimately inhibiting NK cell activity to prevent cell lysis. This regulatory role is facilitated through interactions with ARRB2. Moreover, KIR2DL1 engages with PTPN6 and PTPN11, with the interaction being enhanced by ARRB2, further emphasizing its involvement in intricate signaling networks that modulate NK cell function.

Species

Human

Source

HEK293

Tag

C-Avi;C-8*His

Accession

P43626-1 (H22-R242)

Gene ID
Molecular Construction
N-term
KIR2DL1 (H22-R242)
Accession # P43626-1
8*His-Avi
C-term
Protein Length

Extracellular Domain

Conjugation

Biotin

Synonyms
CD158Ankat1; CD158A; cl-42; KIR2DL1; NKAT; NKAT-1; p58.1; KIR-K64; KIR221; KIR2DL1/KIR2DS5
AA Sequence

HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDIVIIGLYEKPSLSAQLGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGTFQADFPLGPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPR

Molecular Weight

42-60 kDa

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

KIR2DL1 Protein, Human (Biotinylated, HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
KIR2DL1 Protein, Human (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P78165
Quantity:
MCE Japan Authorized Agent: