KIR2DL3 Protein, Human (Biotinylated, HEK293, His-Avi)

KIR2DL3, found on NK cells, selectively recognizes HLA-C alleles like HLA-Cw1, HLA-Cw3, and HLA-Cw7. Its interaction leads to inhibitory effects, preventing NK cell activity and cell lysis. KIR2DL3's association with ARRB2 underscores its role in cellular signaling pathways, intricately modulating NK cell functions. KIR2DL3 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived KIR2DL3 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

KIR2DL3, expressed on natural killer (NK) cells, functions as a receptor specifically recognizing HLA-C alleles, such as HLA-Cw1, HLA-Cw3, and HLA-Cw7. Through this interaction, KIR2DL3 exerts inhibitory effects on NK cell activity, playing a crucial role in preventing cell lysis. The receptor further engages with ARRB2, highlighting its involvement in intricate cellular signaling pathways that modulate NK cell functions.

Human

HEK293

C-Avi;C-8*His

P43628-1 (H22-H245)

3804  [NCBI]

Extracellular Domain

Biotin

HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH

45-52 kDa

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder.

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.