KIR2DL3 Protein, Human (Biotinylated, HEK293, His-Avi)
Based on 1 Customer Validation
KIR2DL3, found on NK cells, selectively recognizes HLA-C alleles like HLA-Cw1, HLA-Cw3, and HLA-Cw7. Its interaction leads to inhibitory effects, preventing NK cell activity and cell lysis. KIR2DL3's association with ARRB2 underscores its role in cellular signaling pathways, intricately modulating NK cell functions. KIR2DL3 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived KIR2DL3 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
KIR2DL3, found on NK cells, selectively recognizes HLA-C alleles like HLA-Cw1, HLA-Cw3, and HLA-Cw7. Its interaction leads to inhibitory effects, preventing NK cell activity and cell lysis. KIR2DL3's association with ARRB2 underscores its role in cellular signaling pathways, intricately modulating NK cell functions. KIR2DL3 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived KIR2DL3 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
Background
KIR2DL3, expressed on natural killer (NK) cells, functions as a receptor specifically recognizing HLA-C alleles, such as HLA-Cw1, HLA-Cw3, and HLA-Cw7. Through this interaction, KIR2DL3 exerts inhibitory effects on NK cell activity, playing a crucial role in preventing cell lysis. The receptor further engages with ARRB2, highlighting its involvement in intricate cellular signaling pathways that modulate NK cell functions.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-8*His
-
Accession
P43628-1 (H22-H245)
-
Molecular Construction
-
N-term
-
KIR2DL3 (H22-H245)
Accession # P43628-1 -
8*His-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Synonyms
KIR2DL3; Killer Cell Immunoglobulin-Like Receptor 2DL2; Killer Cell Immunoglobulin Like Receptor, Two Ig Domains And Long Cytoplasmic Tail 3; Killer Cell Immunoglobulin-Like Receptor; CD158B2; Natural Killer Cell Inhibitory Receptor; Nkat2a; Natural Kille
-
AA Sequence
HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH
-
Predicted Molecular Mass
27.3 kDa
-
Molecular Weight
Approximately 45-52 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)