1. Recombinant Proteins
  2. Receptor Proteins Biotinylated Proteins
  3. Killer-Cell Immunoglobulin-like Receptors
  4. CD158b1/KIR2DL2
  5. KIR2DL2/CD158b1 Protein, Human (Biotinylated, HEK293, His-Avi)

KIR2DL2/CD158b1 Protein, Human (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P77971
Handling Instructions Technical Support

KIR2DL2/CD158b1, found on NK cells, functions as a receptor for HLA-Cw1, Cw3, Cw7, and Cw8 allotypes. Its key role is to inhibit NK cell activity, serving as a regulator to prevent cellular lysis. Interacting with specific HLA-C molecules, KIR2DL2/CD158b1 contributes to the delicate balance of inhibitory signals in the immune system, shaping the responsiveness of NK cells to potential targets. KIR2DL2/CD158b1 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived KIR2DL2/CD158b1 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

KIR2DL2/CD158b1, found on NK cells, functions as a receptor for HLA-Cw1, Cw3, Cw7, and Cw8 allotypes. Its key role is to inhibit NK cell activity, serving as a regulator to prevent cellular lysis. Interacting with specific HLA-C molecules, KIR2DL2/CD158b1 contributes to the delicate balance of inhibitory signals in the immune system, shaping the responsiveness of NK cells to potential targets. KIR2DL2/CD158b1 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived KIR2DL2/CD158b1 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

KIR2DL2/CD158b1, located on natural killer (NK) cells, serves as a receptor for HLA-Cw1, Cw3, Cw7, and Cw8 allotypes. Its primary function is to exert inhibitory effects on NK cell activity, acting as a regulator to prevent cellular lysis. Through specific interactions with distinct HLA-C molecules, KIR2DL2/CD158b1 contributes to the finely tuned balance of inhibitory signals within the immune system, influencing the responsiveness of NK cells to potential targets.

Species

Human

Source

HEK293

Tag

C-Avi;C-8*His

Accession

P43627 (H22-H245)

Gene ID
Molecular Construction
N-term
CD158b1 (H22-H245)
Accession # P43627
8*His-Avi
C-term
Protein Length

Extracellular Domain

Conjugation

Biotin

Synonyms
Killer cell immunoglobulin-like receptor 2DL2; CD158 antigen-like family member B1; MHC class I NK cell receptor; NKAT-6; p58 NK receptor CL-43; CD158b1; KIR2DL2; CD158B1; NKAT6
AA Sequence

HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVIGNPSNSWPSPTEPSSKTGNPRHLH

Predicted Molecular Mass
27.4 kDa
Molecular Weight

Approximately 45-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 95%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

KIR2DL2/CD158b1 Protein, Human (Biotinylated, HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

KIR2DL2/CD158b1 Protein, Human (Biotinylated, HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
KIR2DL2/CD158b1 Protein, Human (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P77971
Quantity:
MCE Japan Authorized Agent: