LAMP2/CD107b Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
The LAMP2/CD107b protein is a lysosomal membrane glycoprotein critical for lysosomal biogenesis, pH regulation, and autophagy.As a direct inhibitor of TMEM175, LAMP2 promotes lysosomal acidification and optimizes hydrolase activity.LAMP2/CD107b Protein, Mouse (HEK293, His) is the recombinant mouse-derived LAMP2/CD107b protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The LAMP2/CD107b protein is a lysosomal membrane glycoprotein critical for lysosomal biogenesis, pH regulation, and autophagy.As a direct inhibitor of TMEM175, LAMP2 promotes lysosomal acidification and optimizes hydrolase activity.LAMP2/CD107b Protein, Mouse (HEK293, His) is the recombinant mouse-derived LAMP2/CD107b protein, expressed by HEK293 , with C-His labeled tag.
Background
LAMP2/CD107b protein, a lysosomal membrane glycoprotein, plays a crucial role in lysosome biogenesis, lysosomal pH regulation, and autophagy. Acting as a direct inhibitor of the proton channel TMEM175, LAMP2 facilitates lysosomal acidification, optimizing hydrolase activity. Additionally, it is a key regulator of chaperone-mediated autophagy, binding target proteins like GAPDH, NLRP3, and MLLT11, and guiding them for lysosomal degradation. Functioning downstream of chaperones such as HSPA8/HSC70, LAMP2 aids in the recruitment of substrate proteins to lysosomes. LAMP2 is vital for lysosomal protein degradation in response to starvation and is essential for the fusion of autophagosomes with lysosomes during autophagy. Its absence leads to impaired fusion and inefficient degradation of autophagic contents. Furthermore, LAMP2 contributes to MHCII-mediated presentation of exogenous antigens. Structurally, LAMP2 exists as a monomer and forms large homooligomers, interacting with proteins like HSPA8, HSP90, MLLT11, ABCB9, FURIN, and TMEM175 to execute its diverse cellular functions.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse LAMP2/CD107b is immobilized at 1µg/mL (100 µL/well) can bind Biotinylated Human Galectin-3. The ED50 for this effect is 2.059 μg/mL.
MCE Validation Data
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-10*His
-
Accession
P17047 (L26-N379)
-
Molecular Construction
-
N-term
-
LAMP2 (L26-N379)
Accession # P17047 -
10*His
-
C-term
-
-
Protein Length
Lumenal Domain
-
Synonyms
LAMP2; LAMP-2; Lysosome Associated Membrane Protein 2; LGP-96; Lysosomal Associated Membrane Protein 2; Lysosome-Associated Membrane Protein 2; Lysosome-Associated Membrane Glycoprotein 2; CD107b Antigen; CD107 Antigen-Like Family Member B; LGP110; CD107b
-
AA Sequence
LIVNLTDSKGTCLYAEWEMNFTITYETTNQTNKTITIAVPDKATHDGSSCGDDRNSAKIMIQFGFAVSWAVNFTKEASHYSIHDIVLSYNTSDSTVFPGAVAKGVHTVKNPENFKVPLDVIFKCNSVLTYNLTPVVQKYWGIHLQAFVQNGTVSKNEQVCEEDQTPTTVAPIIHTTAPSTTTTLTPTSTPTPTPTPTPTVGNYSIRNGNTTCLLATMGLQLNITEEKVPFIFNINPATTNFTGSCQPQSAQLRLNNSQIKYLDFIFAVKNEKRFYLKEVNVYMYLANGSAFNISNKNLSFWDAPLGSSYMCNKEQVLSVSRAFQINTFNLKVQPFNVTKGQYSTAQDCSADEDN
-
Predicted Molecular Mass
40.6 kDa
-
Molecular Weight
Approximately 70-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)