LAMP2/CD107b Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

The LAMP2/CD107b protein is a lysosomal membrane glycoprotein critical for lysosomal biogenesis, pH regulation, and autophagy.As a direct inhibitor of TMEM175, LAMP2 promotes lysosomal acidification and optimizes hydrolase activity.LAMP2/CD107b Protein, Mouse (HEK293, His) is the recombinant mouse-derived LAMP2/CD107b protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The LAMP2/CD107b protein is a lysosomal membrane glycoprotein critical for lysosomal biogenesis, pH regulation, and autophagy.As a direct inhibitor of TMEM175, LAMP2 promotes lysosomal acidification and optimizes hydrolase activity.LAMP2/CD107b Protein, Mouse (HEK293, His) is the recombinant mouse-derived LAMP2/CD107b protein, expressed by HEK293 , with C-His labeled tag.

Background

LAMP2/CD107b protein, a lysosomal membrane glycoprotein, plays a crucial role in lysosome biogenesis, lysosomal pH regulation, and autophagy. Acting as a direct inhibitor of the proton channel TMEM175, LAMP2 facilitates lysosomal acidification, optimizing hydrolase activity. Additionally, it is a key regulator of chaperone-mediated autophagy, binding target proteins like GAPDH, NLRP3, and MLLT11, and guiding them for lysosomal degradation. Functioning downstream of chaperones such as HSPA8/HSC70, LAMP2 aids in the recruitment of substrate proteins to lysosomes. LAMP2 is vital for lysosomal protein degradation in response to starvation and is essential for the fusion of autophagosomes with lysosomes during autophagy. Its absence leads to impaired fusion and inefficient degradation of autophagic contents. Furthermore, LAMP2 contributes to MHCII-mediated presentation of exogenous antigens. Structurally, LAMP2 exists as a monomer and forms large homooligomers, interacting with proteins like HSPA8, HSP90, MLLT11, ABCB9, FURIN, and TMEM175 to execute its diverse cellular functions.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse LAMP2/CD107b is immobilized at 1µg/mL (100 µL/well) can bind Biotinylated Human Galectin-3. The ED50 for this effect is 2.059 μg/mL.

MCE Validation Data

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse LAMP 2/CD107b is immobilized at 1µg/mL (100 µL/well) can bind Biotinylated Human Galectin-3. The ED50 for this effect is 2.059 μg/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • LAMP2 (L26-N379)
      Accession # P17047
    • 10*His
    • C-term
  • Protein Length

    Lumenal Domain

  • Synonyms

    LAMP2; LAMP-2; Lysosome Associated Membrane Protein 2; LGP-96; Lysosomal Associated Membrane Protein 2; Lysosome-Associated Membrane Protein 2; Lysosome-Associated Membrane Glycoprotein 2; CD107b Antigen; CD107 Antigen-Like Family Member B; LGP110; CD107b

  • AA Sequence

    LIVNLTDSKGTCLYAEWEMNFTITYETTNQTNKTITIAVPDKATHDGSSCGDDRNSAKIMIQFGFAVSWAVNFTKEASHYSIHDIVLSYNTSDSTVFPGAVAKGVHTVKNPENFKVPLDVIFKCNSVLTYNLTPVVQKYWGIHLQAFVQNGTVSKNEQVCEEDQTPTTVAPIIHTTAPSTTTTLTPTSTPTPTPTPTPTVGNYSIRNGNTTCLLATMGLQLNITEEKVPFIFNINPATTNFTGSCQPQSAQLRLNNSQIKYLDFIFAVKNEKRFYLKEVNVYMYLANGSAFNISNKNLSFWDAPLGSSYMCNKEQVLSVSRAFQINTFNLKVQPFNVTKGQYSTAQDCSADEDN

  • Predicted Molecular Mass

    40.6 kDa

  • Molecular Weight

    Approximately 70-80 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00