1. Recombinant Proteins
  2. CD Antigens
  3. NK Cell CD Proteins Monocyte CD Proteins Platelet CD Proteins Erythrocyte CD Proteins Endothelial cell CD Proteins
  4. LAMP-2/CD107b
  5. LAMP2/CD107b Protein, Mouse (HEK293, His)

The LAMP2/CD107b protein is a lysosomal membrane glycoprotein critical for lysosomal biogenesis, pH regulation, and autophagy.As a direct inhibitor of TMEM175, LAMP2 promotes lysosomal acidification and optimizes hydrolase activity.LAMP2/CD107b Protein, Mouse (HEK293, His) is the recombinant mouse-derived LAMP2/CD107b protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The LAMP2/CD107b protein is a lysosomal membrane glycoprotein critical for lysosomal biogenesis, pH regulation, and autophagy.As a direct inhibitor of TMEM175, LAMP2 promotes lysosomal acidification and optimizes hydrolase activity.LAMP2/CD107b Protein, Mouse (HEK293, His) is the recombinant mouse-derived LAMP2/CD107b protein, expressed by HEK293 , with C-His labeled tag.

Background

LAMP2/CD107b protein, a lysosomal membrane glycoprotein, plays a crucial role in lysosome biogenesis, lysosomal pH regulation, and autophagy. Acting as a direct inhibitor of the proton channel TMEM175, LAMP2 facilitates lysosomal acidification, optimizing hydrolase activity. Additionally, it is a key regulator of chaperone-mediated autophagy, binding target proteins like GAPDH, NLRP3, and MLLT11, and guiding them for lysosomal degradation. Functioning downstream of chaperones such as HSPA8/HSC70, LAMP2 aids in the recruitment of substrate proteins to lysosomes. LAMP2 is vital for lysosomal protein degradation in response to starvation and is essential for the fusion of autophagosomes with lysosomes during autophagy. Its absence leads to impaired fusion and inefficient degradation of autophagic contents. Furthermore, LAMP2 contributes to MHCII-mediated presentation of exogenous antigens. Structurally, LAMP2 exists as a monomer and forms large homooligomers, interacting with proteins like HSPA8, HSP90, MLLT11, ABCB9, FURIN, and TMEM175 to execute its diverse cellular functions.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse LAMP2/CD107b is immobilized at 1µg/mL (100 µL/well) can bind Biotinylated Human Galectin-3. The ED50 for this effect is 2.059 μg/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Recombinant Mouse LAMP 2/CD107b is immobilized at 1µg/mL (100 µL/well) can bind Biotinylated Human Galectin-3. The ED50 for this effect is 2.059 μg/mL.
Species

Mouse

Source

HEK293

Tag

C-10*His

Accession

P17047 (L26-N379)

Gene ID
Molecular Construction
N-term
LAMP2 (L26-N379)
Accession # P17047
10*His
C-term
Protein Length

Lumenal Domain

Synonyms
Lysosome-Associated Membrane Glycoprotein 2; LAMP-2; CD107b
AA Sequence

LIVNLTDSKGTCLYAEWEMNFTITYETTNQTNKTITIAVPDKATHDGSSCGDDRNSAKIMIQFGFAVSWAVNFTKEASHYSIHDIVLSYNTSDSTVFPGAVAKGVHTVKNPENFKVPLDVIFKCNSVLTYNLTPVVQKYWGIHLQAFVQNGTVSKNEQVCEEDQTPTTVAPIIHTTAPSTTTTLTPTSTPTPTPTPTPTVGNYSIRNGNTTCLLATMGLQLNITEEKVPFIFNINPATTNFTGSCQPQSAQLRLNNSQIKYLDFIFAVKNEKRFYLKEVNVYMYLANGSAFNISNKNLSFWDAPLGSSYMCNKEQVLSVSRAFQINTFNLKVQPFNVTKGQYSTAQDCSADEDN

Molecular Weight

70-80 kDa

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

LAMP2/CD107b Protein, Mouse (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LAMP2/CD107b Protein, Mouse (HEK293, His)
Cat. No.:
HY-P74781
Quantity:
MCE Japan Authorized Agent: