LATS1 Protein, Human (His, Myc)
LATS1 Protein, Human (His, Myc) is the recombinant human-derived LATS1 protein, expressed by E. coli, with C-Myc & N-10*His tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
LATS1 Protein, Human (His, Myc) is the recombinant human-derived LATS1 protein, expressed by E. coli, with C-Myc & N-10*His tag.
Background
LATS1 is a negative regulator of YAP1 in the Hippo signaling pathway, playing a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway consists of a kinase cascade where STK3/MST2 and STK4/MST1, in complex with SAV1, phosphorylate and activate LATS1/2 in complex with MOB1, which then phosphorylates and inactivates the oncoproteins YAP1 and WWTR1/TAZ. Phosphorylation of YAP1 by LATS1 inhibits its nuclear translocation, thereby regulating genes important for cell proliferation, death, and migration. As a tumor suppressor, LATS1 maintains ploidy through its roles in mitotic progression and the G1 tetraploidy checkpoint. It negatively regulates G2/M transition by downregulating CDK1 kinase activity and is involved in controlling p53 expression. Additionally, LATS1 affects cytokinesis by negatively modulating LIMK1 to regulate actin polymerization. It may also function in endocrine processes and promotes mammary gland epithelial cell differentiation through both the Hippo pathway and intracellular estrogen receptor signaling by facilitating ESR1 degradation. Recent studies show LATS1 activates the NLRP3 inflammasome by mediating phosphorylation of NLRP3 at Ser-265 following its palmitoylation.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-Myc;N-10*His
-
Accession
O95835-1 (F705-P1090)
-
Gene ID9113
-
Molecular Construction
-
N-term
-
10*His
-
LATS1 (F705-P1090)
Accession # O95835-1 -
Myc
-
C-term
-
-
Protein Length
Partial
-
Synonyms
LATS1; WARTS Protein Kinase; Large Tumor Suppressor Kinase 1; H-Warts; WARTS; LATS, Large Tumor Suppressor, Homolog 1 (Drosophila); LATS (Large Tumor Suppressor, Drosophila) Homolog 1; LATS, Large Tumor Suppressor, Homolog 1; Serine/Threonine-Protein Kina
-
AA Sequence
FVKIKTLGIGAFGEVCLARKVDTKALYATKTLRKKDVLLRNQVAHVKAERDILAEADNEWVVRLYYSFQDKDNLYFVMDYIPGGDMMSLLIRMGIFPESLARFYIAELTCAVESVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHDSKYYQSGDHPRQDSMDFSNEWGDPSSCRCGDRLKPLERRAARQHQRCLAHSLVGTPNYIAPEVLLRTGYTQLCDWWSVGVILFEMLVGQPPFLAQTPLETQMKVINWQTSLHIPPQAKLSPEASDLIIKLCRGPEDRLGKNGADEIKAHPFFKTIDFSSDLRQQSASYIPKITHPTDTSNFDPVDPDKLWSDDNEEENVNDTLNGWYKNGKHPEHAFYEFTFRRFFDDNGYP
-
Predicted Molecular Mass
49.4 kDa
-
Molecular Weight
Approximately 49 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)