LATS1 Protein, Human (His, Myc)

LATS1 Protein, Human (His, Myc) is the recombinant human-derived LATS1 protein, expressed by E. coli, with C-Myc & N-10*His tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

LATS1 Protein, Human (His, Myc) is the recombinant human-derived LATS1 protein, expressed by E. coli, with C-Myc & N-10*His tag.

Background

LATS1 is a negative regulator of YAP1 in the Hippo signaling pathway, playing a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway consists of a kinase cascade where STK3/MST2 and STK4/MST1, in complex with SAV1, phosphorylate and activate LATS1/2 in complex with MOB1, which then phosphorylates and inactivates the oncoproteins YAP1 and WWTR1/TAZ. Phosphorylation of YAP1 by LATS1 inhibits its nuclear translocation, thereby regulating genes important for cell proliferation, death, and migration. As a tumor suppressor, LATS1 maintains ploidy through its roles in mitotic progression and the G1 tetraploidy checkpoint. It negatively regulates G2/M transition by downregulating CDK1 kinase activity and is involved in controlling p53 expression. Additionally, LATS1 affects cytokinesis by negatively modulating LIMK1 to regulate actin polymerization. It may also function in endocrine processes and promotes mammary gland epithelial cell differentiation through both the Hippo pathway and intracellular estrogen receptor signaling by facilitating ESR1 degradation. Recent studies show LATS1 activates the NLRP3 inflammasome by mediating phosphorylation of NLRP3 at Ser-265 following its palmitoylation.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-Myc;N-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 10*His
    • LATS1 (F705-P1090)
      Accession # O95835-1
    • Myc
    • C-term
  • Protein Length

    Partial

  • Synonyms

    LATS1; WARTS Protein Kinase; Large Tumor Suppressor Kinase 1; H-Warts; WARTS; LATS, Large Tumor Suppressor, Homolog 1 (Drosophila); LATS (Large Tumor Suppressor, Drosophila) Homolog 1; LATS, Large Tumor Suppressor, Homolog 1; Serine/Threonine-Protein Kina

  • AA Sequence

    FVKIKTLGIGAFGEVCLARKVDTKALYATKTLRKKDVLLRNQVAHVKAERDILAEADNEWVVRLYYSFQDKDNLYFVMDYIPGGDMMSLLIRMGIFPESLARFYIAELTCAVESVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHDSKYYQSGDHPRQDSMDFSNEWGDPSSCRCGDRLKPLERRAARQHQRCLAHSLVGTPNYIAPEVLLRTGYTQLCDWWSVGVILFEMLVGQPPFLAQTPLETQMKVINWQTSLHIPPQAKLSPEASDLIIKLCRGPEDRLGKNGADEIKAHPFFKTIDFSSDLRQQSASYIPKITHPTDTSNFDPVDPDKLWSDDNEEENVNDTLNGWYKNGKHPEHAFYEFTFRRFFDDNGYP

  • Predicted Molecular Mass

    49.4 kDa

  • Molecular Weight

    Approximately 49 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 85%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00