MAGP-2/MFAP5 Protein, Human (HEK293, His)
Based on 1 Customer Validation
MAGP-2/MFAP5 protein may affect hematopoiesis and participate in blood cell formation. In the cardiovascular system, it regulates growth factors, maintains the integrity of large blood vessels through cell signaling, and contributes to the structural organization of elastin-associated microfibrils. MAGP-2/MFAP5 Protein, Human (HEK293, His) is the recombinant human-derived MAGP-2/MFAP5 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MAGP-2/MFAP5 protein may affect hematopoiesis and participate in blood cell formation. In the cardiovascular system, it regulates growth factors, maintains the integrity of large blood vessels through cell signaling, and contributes to the structural organization of elastin-associated microfibrils. MAGP-2/MFAP5 Protein, Human (HEK293, His) is the recombinant human-derived MAGP-2/MFAP5 protein, expressed by HEK293 , with C-His labeled tag.
Background
The MAGP-2/MFAP5 protein is suggested to potentially play a role in hematopoiesis, indicating its involvement in crucial processes related to blood cell formation. In the cardiovascular system, it is proposed to regulate growth factors or participate in cell signaling to maintain the integrity of large vessels. Notably, MAGP-2/MFAP5 functions as a component of the elastin-associated microfibrils, contributing to the structural organization of these extracellular matrix elements. Additionally, it interacts with key signaling molecules such as TGFB2 and BMP2, suggesting a role in modulating signaling pathways. Furthermore, MAGP-2/MFAP5 engages in interactions with FBN1 and FBN2, emphasizing its involvement in the dynamic network of proteins associated with fibrillin and contributing to the overall maintenance of tissue architecture and function. The multifaceted functions and molecular interactions of MAGP-2/MFAP5 underscore its significance in both hematopoiesis and cardiovascular homeostasis.
Verified Bioactivity
1.MFAP5 immobilized on CM5 Chip can bind TGFB1 (HY-P70543) with an affinity constant of 0.4752 μM as determined in SPR assay.
2.Immobilized Human TGFB1 (HY-P70543) at 2 μg/mL (100 μL/well) can bind Biotinylated Human MAGP-2/MFAP5 Protein, the ED50 for this effect is 0.8-1.5 μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - SPR
Bioactivity - SPR
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
Q13361-1 (I22-L173)
-
Molecular Construction
-
N-term
-
MAGP-2 (I22-L173)
Accession # Q13361-1 -
His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
MFAP5; MAGP-2; Microfibril Associated Protein 5; MFAP-5; MAGP2; CDNA FLJ42377 Fis, Clone UTERU2035469, Highly Similar To Microfibrillar-Associated Protein 5; MP25; Microfibril-Associated Glycoprotein 2; Microfibril-Associated Glycoprotein-2; THE1A-MFAP5;
-
AA Sequence
IPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL
-
Molecular Weight
Approximately 25-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
