MARK4 Protein, Human (Active, His)
MARK4 is a key serine/threonine protein kinase with crucial effects on cellular processes. It phosphorylates microtubule-associated proteins (MAPT/TAU, MAP2, MAP4) and reorganizes the microtubule network. MARK4 Protein, Human (His) is the recombinant human-derived MARK4 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
Biological Activity
MARK4 is a key serine/threonine protein kinase with crucial effects on cellular processes. It phosphorylates microtubule-associated proteins (MAPT/TAU, MAP2, MAP4) and reorganizes the microtubule network. MARK4 Protein, Human (His) is the recombinant human-derived MARK4 protein, expressed by E. coli , with N-6*His labeled tag.
MARK4, a serine/threonine-protein kinase, plays a crucial role in diverse cellular processes. It phosphorylates microtubule-associated proteins, including MAPT/TAU, MAP2, and MAP4, leading to the reorganization of the microtubule network into bundles. Essential for the initiation of axoneme extension during cilium assembly, MARK4 regulates the centrosomal location of ODF2. Additionally, it contributes to cell cycle progression at the G1/S checkpoint and is implicated in neuronal cell survival. Beyond its cellular functions, MARK4 influences energy homeostasis by modulating satiety and metabolic rate. It promotes adipogenesis through JNK1 activation, inhibits the p38MAPK pathway, and triggers apoptosis via JNK1 activation. Furthermore, MARK4 negatively regulates the mTORC1 complex by phosphorylating RPTOR, disrupting its interaction with the RRAGA/RRAGC heterodimer essential for mTORC1 activation. In the context of inflammasome activation, MARK4 participates in NLRP3 positioning along microtubules, mediating its recruitment to the microtubule organizing center.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q96L34 (N44-K370)
-
Gene ID57787
-
Molecular Construction
-
N-term
-
6*His
-
MARK4 (N44-K370)
Accession # Q96L34 -
C-term
-
-
Protein Length
Partial
-
Synonyms
MARK4; FLJ90097; Prev. MARKL1; Non-Specific Serine/Threonine Protein Kinase; MAP/Microtubule Affinity-Regulating Kinase 4; Epididymis Secretory Sperm Binding Protein; KIAA1860; MARK4 Serine/Threonine Protein Kinase; PAR-1D; MARKL1L; MAP/Microtubule Affini
-
AA Sequence
NSIASCPEEQPHVGNYRLLRTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPSSLQKLFREVRIMKGLNHPNIVKLFEVIETEKTLYLVMEYASAGEVFDYLVSHGRMKEKEARAKFRQIVSAVHYCHQKNIVHRDLKAENLLLDAEANIKIADFGFSNEFTLGSKLDTFCGSPPYAAPELFQGKKYDGPEVDIWSLGVILYTLVSGSLPFDGHNLKELRERVLRGKYRVPFYMSTDCESILRRFLVLNPAKRCTLEQIMKDKWINIGYEGEELKPYTEPEEDFGDTKRIEVMVGMGYTREEIKESLTSQKYNEVTATYLLLGRK
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)