MARK4 Protein, Human (Active, His)

Customer Review

Based on 1 Customer Validation

MARK4 is a key serine/threonine protein kinase with crucial effects on cellular processes. It phosphorylates microtubule-associated proteins (MAPT/TAU, MAP2, MAP4) and reorganizes the microtubule network. MARK4 Protein, Human (His) is the recombinant human-derived MARK4 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

MARK4 is a key serine/threonine protein kinase with crucial effects on cellular processes. It phosphorylates microtubule-associated proteins (MAPT/TAU, MAP2, MAP4) and reorganizes the microtubule network. MARK4 Protein, Human (His) is the recombinant human-derived MARK4 protein, expressed by E. coli , with N-6*His labeled tag.

Background

MARK4, a serine/threonine-protein kinase, plays a crucial role in diverse cellular processes. It phosphorylates microtubule-associated proteins, including MAPT/TAU, MAP2, and MAP4, leading to the reorganization of the microtubule network into bundles. Essential for the initiation of axoneme extension during cilium assembly, MARK4 regulates the centrosomal location of ODF2. Additionally, it contributes to cell cycle progression at the G1/S checkpoint and is implicated in neuronal cell survival. Beyond its cellular functions, MARK4 influences energy homeostasis by modulating satiety and metabolic rate. It promotes adipogenesis through JNK1 activation, inhibits the p38MAPK pathway, and triggers apoptosis via JNK1 activation. Furthermore, MARK4 negatively regulates the mTORC1 complex by phosphorylating RPTOR, disrupting its interaction with the RRAGA/RRAGC heterodimer essential for mTORC1 activation. In the context of inflammasome activation, MARK4 participates in NLRP3 positioning along microtubules, mediating its recruitment to the microtubule organizing center.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • MARK4 (N44-K370)
      Accession # Q96L34-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    MARK4; FLJ90097; Prev. MARKL1; Non-Specific Serine/Threonine Protein Kinase; MAP/Microtubule Affinity-Regulating Kinase 4; Epididymis Secretory Sperm Binding Protein; KIAA1860; MARK4 Serine/Threonine Protein Kinase; PAR-1D; MARKL1L; MAP/Microtubule Affinity-Regulating Kinase Like 1; MARK4L; Nbla00650; MARK4S; Microtubule Affinity Regulating Kinase 4; MAP/Microtubule Affinity-Regulating Kinase-Like 1

  • AA Sequence

    NSIASCPEEQPHVGNYRLLRTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPSSLQKLFREVRIMKGLNHPNIVKLFEVIETEKTLYLVMEYASAGEVFDYLVSHGRMKEKEARAKFRQIVSAVHYCHQKNIVHRDLKAENLLLDAEANIKIADFGFSNEFTLGSKLDTFCGSPPYAAPELFQGKKYDGPEVDIWSLGVILYTLVSGSLPFDGHNLKELRERVLRGKYRVPFYMSTDCESILRRFLVLNPAKRCTLEQIMKDKWINIGYEGEELKPYTEPEEDFGDTKRIEVMVGMGYTREEIKESLTSQKYNEVTATYLLLGRK

  • Molecular Weight

    Approximately 39 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00