MCP-1/CCL2 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

MCP-1/CCL2 Protein, Mouse (HEK293, His) is a cytokine belonging to the CC chemokine family that interacts with the CCR2 chemokine receptor on the cell surface to mediate inflammatory immune responses, viral infections, and tumorigenesis. MCP-1/CCL2 Protein, Mouse (HEK293, His) is a mouse MCP-1/CCL2 expressed by HEK293 with a His tag at the C-terminus.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

MCP-1/CCL2 Protein, Mouse (HEK293, His) is a cytokine belonging to the CC chemokine family that interacts with the CCR2 chemokine receptor on the cell surface to mediate inflammatory immune responses, viral infections, and tumorigenesis. MCP-1/CCL2 Protein, Mouse (HEK293, His) is a mouse MCP-1/CCL2 expressed by HEK293 with a His tag at the C-terminus[1].

Background

CCL2, also known as monocyte chemotactic protein 1 (MCP1), is a small cell factor belonging to the CC chemokine family. The CCL2 gene, located in the q11.2-q12 region of human chromosome 17, encodes a monomeric polypeptide with a molecular weight of 9-15 kDa, depending on the level of glycosylation. CCL2 is mainly secreted by monocytes, macrophages and dendritic cells. It is secreted by monocytes, macrophages and dendritic cells, and platelet-derived growth factor is the main inducer of the CCL2 gene. Astrocytes and microglia are also thought to be the source of CCL2[1]. CCL2 signals through binding to and activation of CCR2 and induces a strong chemotactic response and intracellular mobilization of calcium ions. Among other things, CCL2/CCR2 can regulate cell adhesion and chemotaxis of macrophages by activating the β1 integrin and p38-MAPK signaling pathways. In addition to acting as a chemoattractant, CCL2 can also regulate brain endothelial permeability in vitro by altering tight junction (TJ) proteins and regulating the expression of endothelial adhesion molecules and leukocyte integrins as well as cytokine production. In addition, the CCL2-CCR2 signaling axis has been implicated in many inflammatory and neurodegenerative diseases, acting to recruit inflammatory cells into the CNS[2].  Originally described as a "tumor-derived chemokine", CCL2 has been shown to be a potent chemokine for many types of immune cells and a potential target for the treatment of many diseases, such as atherosclerosis, multiple sclerosis, asthma, neuropathic pain, diabetic nephropathy, and cancer[3].

In Vitro

MCP-1/CCL2 (100 ng/mL, 24 h) can induce NO production by co-treatment with IFN-γ, increases ERK phosphorylation and increases iNOS expression, suggesting that the mechanism of NO production is related to the ERK1/2 signaling pathway in peritoneal macrophages of mice, thereby increasing bacterial clearance[3].
CCL2 (0.05 ng/μL) promotes α-synuclein secretion and α-synuclein-induced neuronal apoptosis, and induces microglia proliferation and secretion of TNF-α, IL-1β and NO[4].

In Vivo

MCP-1/CCL2 (intracerebral injection, 5-25 μg, 1 μL/h for 3 days or 0.5 μL/h for 7 days) induces FITC-albumin leakage at lower concentrations (5-20 μg) but fails or moderately induces leukocyte infiltration. Blood-brain barrier permeability and leukocyte infiltration are significantly increased at 25 μg, and extravasation is significantly enhanced in the treated CD-1 mice compared with the control group 6 h after injection. Prolonged administration for 3 or 7 days results in a significant increase in the percentage of brain water content, and decreases expression of the tight junction proteins occludin, claudin-5, ZO-1 and ZO-2[2].

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CCL2 (Q24-N148)
      Accession # P10148
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CCL2; Small Inducible Cytokine Subfamily A (Cys-Cys), Member 2; Prev. SCYA2; Chemokine (C-C Motif) Ligand 2; MCP-1; Monocyte Chemotactic Protein 1; MCP1; Small-Inducible Cytokine A2; MCAF; C-C Motif Chemokine 2; HC11; MGC9434; Monocyte Chemotactic And Act

  • AA Sequence

    QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN

  • Predicted Molecular Mass

    14.7 kDa

  • Molecular Weight

    Approximately 20-36 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, 10% glycerol, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00