1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Chemokine & Receptors
  4. CC Chemokines
  5. CCL22
  6. MDC/CCL22 Protein, Rat

MDC/CCL22 Protein, Rat

Cat. No.: HY-P7249
Handling Instructions

MDC/CCL22 Protein, Rat is a ligand for CCR4 receptor and is a chemoattractant for the CCR4-expressing cells such as Th2 cells.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock
10 μg $190 Ask For Quote & Lead Time
50 μg $420 Ask For Quote & Lead Time

* Please select Quantity before adding items.

MDC/CCL22 Protein, Rat Featured Recommendations:

Top Publications Citing Use of Products

MDC/CCL22 Protein, Rat Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Rat

Source

E. coli

Accession

Q5I0L5 (G25-A92)

Gene ID
Synonyms
rRtMDC/CCL22; C-C motif chemokine 22; Abcd1; SCYA22
AA Sequence

GPYGANVEDSICCQDYIRHPLPPRFVKEFYWTSKSCRKPGVVLITIKNRDICADPRMLWVKKILHKLA

Molecular Weight

Approximately 7.9 kDa

Biological Activity
Full biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 10-100 ng/ml.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 2× PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water or aqueous buffer containing 0.1% BSA.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Active Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific active calculator equation

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Active (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MDC/CCL22 Protein, Rat
Cat. No.:
HY-P7249
Quantity:
MCE Japan Authorized Agent: