1. Recombinant Proteins
  2. MEC/CCL28 Protein, Rat

MEC/CCL28 Protein, Rat

Cat. No.: HY-P7252
Handling Instructions

MEC/CCL28 Protein, Rat is a CC chemokine.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock
10 μg $60 Ask For Quote & Lead Time
50 μg $240 Ask For Quote & Lead Time

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rRtMEC/CCL28; C-C motif chemokine 28; SCYA28
Species

Rat

Source

E. coli

Accession

Q91Y39 (S20-R135)

Gene ID

114492

Molecular Weight

Approximately 13.1 kDa

AA Sequence

SEAILPIASSCCTEVSHHIPRRLLERVNSCSIQRADGDCDLAAVILHVKRRRICVSPHNPTLKRWMSASEMKNGKENLCPRKKQDSGKDRKGHTPRKHGKHGTRRIHGTHDHEAPR

Biological Activity
Full biological activity determined by a chemotaxis bioassay using human lymphocytes is in a concentration range of 5.0-50 ng/ml.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against 20 mM PB, pH 7.4, 200 mM NaCl.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water or aqueous buffer containing 0.1% BSA.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

CCL28/MEC are CC chemokines primarily expressed in thymic dendritic cells and mucosal epithelial cells[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MEC/CCL28 Protein, Rat
Cat. No.:
HY-P7252
Quantity:
MCE Japan Authorized Agent: