Mer Protein, Human (Active, A708S, sf9, His-GST)

Mer protein is a receptor tyrosine kinase that transduces signals by binding to ligands such as LGALS3, TUB, TULP1, or GAS6, regulating cell survival, migration, differentiation, and apoptotic cell phagocytosis (endocytosis). Ligand binding induces autophosphorylation of MERTK, creating a docking site for downstream molecules. Mer, Human (Active, A708S, sf9, His-GST) is the recombinant human-derived Mer protein, expressed by sf9 insect cells, with N-Avi labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Help & FAQs

Biological Activity

Description

Mer protein is a receptor tyrosine kinase that transduces signals by binding to ligands such as LGALS3, TUB, TULP1, or GAS6, regulating cell survival, migration, differentiation, and apoptotic cell phagocytosis (endocytosis). Ligand binding induces autophosphorylation of MERTK, creating a docking site for downstream molecules. Mer, Human (Active, A708S, sf9, His-GST) is the recombinant human-derived Mer protein, expressed by sf9 insect cells, with N-Avi labeled tag.

Background

The Mer protein, a receptor tyrosine kinase, transduces signals from the extracellular matrix by binding to various ligands, including LGALS3, TUB, TULP1, or GAS6. It is involved in regulating diverse physiological processes, including cell survival, migration, differentiation, and the phagocytosis of apoptotic cells (efferocytosis). Ligand binding at the cell surface induces autophosphorylation of MERTK on its intracellular domain, creating docking sites for downstream signaling molecules. Upon activation by ligand, Mer interacts with GRB2 or PLCG2 and induces the phosphorylation of MAPK1, MAPK2, FAK/PTK2, or RAC1. MERTK signaling is implicated in macrophage clearance of apoptotic cells, platelet aggregation, cytoskeleton reorganization, and engulfment. In the retinal pigment epithelium (RPE), it serves as a regulator of rod outer segment fragments' phagocytosis. Moreover, Mer plays a crucial role in inhibiting Toll-like receptors (TLRs)-mediated innate immune responses by activating STAT1, which selectively induces the production of suppressors of cytokine signaling SOCS1 and SOCS3.

Technical Parameters

  • Species Human
  • Source sf9 insect cells
  • Tag N-His;N-GST
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His-GST
    • (E578-Y872, A708S)
      Accession # Q12866
    • C-term
  • Protein Length

    Partial

  • Synonyms

    MERTK; Mer; MER Proto-Oncogene, Tyrosine Kinase; C-Mer Proto-Oncogene Tyrosine Kinase; Receptor Tyrosine Kinase MerTK; Receptor Protein-Tyrosine Kinase; Tyrosine-Protein Kinase Mer; Uncharacterized Protein MERTK; Proto-Oncogene C-Mer; MER Receptor Tyrosin

  • AA Sequence

    EDVVIDRNLLILGKILGEGEFGSVMEGNLKQEDGTSLKVAVKTMKLDNSSQREIEEFLSEAACMKDFSHPNVIRLLGVCIEMSSQGIPKPMVILPFMKYGDLHTYLLYSRLETGPKHIPLQTLLKFMVDISLGMEYLSNRNFLHRDLAARNCMLRDDMTVCVADFGLSKKIYSGDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWAFGVTMWEIATRGMTPYPGVQNHEMYDYLLHGHRLKQPEDCLDELYEIMYSCWRTDPLDRPTFSVLRLQLEKLLESLPDVRNQADVIY

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipped with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00