Mer Protein, Mouse (Active, sf9, His-GST)
Mer protein is a receptor tyrosine kinase that transduces signals by binding to ligands such as LGALS3, TUB, TULP1 or GAS6.Mer is critical in processes such as cell survival, migration, differentiation, and phagocytosis of apoptotic cells, and autophosphorylation occurs upon ligand binding.Mer Protein, Mouse (sf9, His-GST) is the recombinant mouse-derived Mer protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.
- Species: Mouse
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Mer protein is a receptor tyrosine kinase that transduces signals by binding to ligands such as LGALS3, TUB, TULP1 or GAS6.Mer is critical in processes such as cell survival, migration, differentiation, and phagocytosis of apoptotic cells, and autophosphorylation occurs upon ligand binding.Mer Protein, Mouse (sf9, His-GST) is the recombinant mouse-derived Mer protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.
Background
The Mer protein is a receptor tyrosine kinase that mediates cellular signaling from the extracellular matrix to the cytoplasm through binding to ligands such as LGALS3, TUB, TULP1, or GAS6. It plays a crucial role in various physiological processes, including cell survival, migration, differentiation, and the phagocytosis of apoptotic cells. Activation of Mer by ligand binding leads to autophosphorylation on its intracellular domain, creating binding sites for downstream signaling molecules. This, in turn, triggers interactions with GRB2 or PLCG2 and subsequent phosphorylation of MAPK1, MAPK2, FAK/PTK2, or RAC1. Mer signaling is involved in macrophage clearance of apoptotic cells, platelet aggregation, cytoskeleton reorganization, and engulfment. Notably, within the retinal pigment epithelium (RPE), Mer serves as a regulator of phagocytosis of rod outer segment fragments. Additionally, Mer plays a pivotal role in inhibiting the innate immune response triggered by Toll-like receptors (TLRs) by activating STAT1, which selectively induces the production of suppressors of cytokine signaling SOCS1 and SOCS3.
Technical Parameters
-
Species Mouse
-
Source Sf9 insect cells
-
Tag N-His;N-GST
-
Accession
Q60805 (E573-Y867)
-
Molecular Construction
-
N-term
-
His-GST
-
Mer (E573-Y867)
Accession # Q60805 -
C-term
-
-
Protein Length
Partial
-
Synonyms
MERTK; Mer; MER Proto-Oncogene, Tyrosine Kinase; C-Mer Proto-Oncogene Tyrosine Kinase; Receptor Tyrosine Kinase MerTK; Receptor Protein-Tyrosine Kinase; Tyrosine-Protein Kinase Mer; Uncharacterized Protein MERTK; Proto-Oncogene C-Mer; MER Receptor Tyrosin
-
AA Sequence
EDVVIDRNLLVLGKVLGEGEFGSVMEGNLKQEDGTSQKVAVKTMKLDNFSQREIEEFLSEAACMKDFNHPNVIRLLGVCIELSSQGIPKPMVILPFMKYGDLHTFLLYSRLNTGPKYIHLQTLLKFMMDIAQGMEYLSNRNFLHRDLAARNCMLRDDMTVCVADFGLSKKIYSGDYYRQGRIAKMPVKWIAIESLADRVYTSKSDVWAFGVTMWEITTRGMTPYPGVQNHEMYDYLLHGHRLKQPEDCLDELYDIMYSCWSADPLDRPTFSVLRLQLEKLSESLPDAQDKESIIY
-
Predicted Molecular Mass
61.7 kDa
-
Molecular Weight
Approximately 58 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
