1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. MIA Protein, Human (N-His)

MIA proteins exhibit significant growth inhibitory effects on melanoma cells in vitro, extending their effects to various neuroectodermal tumors such as gliomas. In addition to playing an inhibitory role in cell growth, MIA proteins are also involved in molecular interactions, interacting with FASLG and TMIGD2. MIA Protein, Human (N-His) is the recombinant human-derived MIA protein, expressed by E. coli , with N-6*His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Precio Stock Cantidad
Muestra gratis   Apply now
Muestra gratis   Apply now
5 μg En stock
10 μg En stock
50 μg En stock
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

MIA proteins exhibit significant growth inhibitory effects on melanoma cells in vitro, extending their effects to various neuroectodermal tumors such as gliomas. In addition to playing an inhibitory role in cell growth, MIA proteins are also involved in molecular interactions, interacting with FASLG and TMIGD2. MIA Protein, Human (N-His) is the recombinant human-derived MIA protein, expressed by E. coli , with N-6*His labeled tag.

Background

Melanoma Inhibitory Activity (MIA) is a protein known for its growth-inhibitory effects on melanoma cells in vitro and displays similar actions on various neuroectodermal tumors, such as gliomas. MIA's ability to elicit growth inhibition suggests its potential role as a tumor suppressor, particularly in the context of malignancies originating from neuroectodermal tissues. Additionally, MIA interacts with FASLG, indicating its involvement in cellular processes related to apoptosis and immune response. Furthermore, its interaction with TMIGD2 suggests a potential role in modulating signaling pathways or cellular adhesion. The multifaceted interactions and growth-inhibitory properties of MIA highlight its significance in the regulation of tumor growth and its potential therapeutic relevance in neuroectodermal cancers.

Actividad biológica

Measured in a cell proliferation assay using human A375 melanoma cell line.The ED50 for this effect is 4-8 μg/mL, corresponding to a specific activity is 135-244 units/mg.

  • Measured in a cell proliferation assay using human A375 melanoma cell line.The ED50 for this effect is 4-8 μg/mL, corresponding to a specific activity is 135-244 units/mg.
Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q16674 (G25-Q131)

Gene ID
Molecular Construction
N-term
6*His
MIA (G25-Q131)
Accession # Q16674
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Melanoma-Derived Growth Regulatory Protein; Melanoma Inhibitory Activity Protein; MIA
AA Sequence

GPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ

Predicted Molecular Mass
12.1 kDa
Peso molecular

Approximately 14.0 kDa, based on SDS-PAGE under reducing conditions.

Pureza
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, 200 mM arginine, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Envío

Room temperature in continental US; may vary elsewhere.

Documentación

MIA Protein, Human (N-His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

MIA Protein, Human (N-His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
MIA Protein, Human (N-His)
Cat. No.:
HY-P70846A
Cantidad:
MCE Japan Authorized Agent: