MIF Protein, Mouse (His)
The MIF protein is a pro-inflammatory cytokine that plays a crucial role in the innate immune response against bacterial pathogens.Its presence at sites of inflammation suggests its role as a mediator in the regulation of macrophage function during host defense.MIF Protein, Mouse (His) is the recombinant mouse-derived MIF protein, expressed by E.coli , with C-6*His labeled tag.
- Species: Mouse
- Source: E. coli
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The MIF protein is a pro-inflammatory cytokine that plays a crucial role in the innate immune response against bacterial pathogens.Its presence at sites of inflammation suggests its role as a mediator in the regulation of macrophage function during host defense.MIF Protein, Mouse (His) is the recombinant mouse-derived MIF protein, expressed by E.coli , with C-6*His labeled tag.
MIF Protein, a pro-inflammatory cytokine, plays a crucial role in the innate immune response to bacterial pathogens. Its expression at inflammatory sites suggests its involvement as a mediator in regulating macrophage function during host defense. Notably, MIF counters the anti-inflammatory activity of glucocorticoids. While it exhibits phenylpyruvate tautomerase and dopachrome tautomerase activities in vitro, the physiological substrate remains unknown. The significance of its tautomerase activity and its relevance to cytokine function remain unclear.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag C-6*His
-
Accession
P34884 (P2-A115)
-
Molecular Construction
-
N-term
-
MIF (P2-A115)
Accession # P34884 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
MIF; L-Dopachrome Isomerase; Prev. GLIF; Glycosylation-Inhibiting Factor; Phenylpyruvate Tautomerase; MMIF; GIF; Epididymis Secretory Sperm Binding Protein; L-Dopachrome Tautomerase; Macrophage Migration Inhibitory Factor; Macrophage Migration Inhibitory
-
AA Sequence
PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA
-
Predicted Molecular Mass
13.5 kDa
-
Molecular Weight
Approximately 10-14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
