Copy Link Print Information

MMP-12 Protein, Mouse (HEK293, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

MMP-12 protein has significant elastolytic activity and may contribute to tissue damage and remodeling.Its substrate preferences include preference for leucine at the P1' site and aromatic/hydrophobic residues at the P1 site, and preference for small hydrophobic residues such as alanine at the P3 site.MMP-12 Protein, Mouse (HEK293, His) is the recombinant mouse-derived MMP-12 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Experimental Validation Results for MMP-12 Protein, Mouse (HEK293, His)
  • MMP-12 Protein, Mouse (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

MMP-12 protein has significant elastolytic activity and may contribute to tissue damage and remodeling.Its substrate preferences include preference for leucine at the P1' site and aromatic/hydrophobic residues at the P1 site, and preference for small hydrophobic residues such as alanine at the P3 site.MMP-12 Protein, Mouse (HEK293, His) is the recombinant mouse-derived MMP-12 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

The MMP-12 protein emerges as a potential contributor to tissue injury and remodeling, demonstrating significant elastolytic activity. Its versatility is reflected in its ability to accommodate both large and small amino acids at the P1' site, displaying a preference for leucine. Furthermore, MMP-12 exhibits specificity in substrate preferences, favoring aromatic or hydrophobic residues at the P1 site, with a preference for small hydrophobic residues, particularly alanine, at the P3 site. These characteristics underscore the intricate role of MMP-12 in the modulation of extracellular matrix components, suggesting its involvement in processes related to tissue remodeling and homeostasis.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Assay Procedure

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet. (The proenzyme needs to be activated by APMA for an activated form.)

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-6*His
  • Accession

    P34960 (A29-C473)

  • Gene ID
    17381  [NCBI]
  • Molecular Construction
    • N-term
    • MMP-12 (A29-C473)
      Accession # P34960
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein (with propeptide)

  • Synonyms

    MMP12; MMP-12; Matrix Metallopeptidase 12; MME; HME; ME; Matrix Metalloproteinase 12 (Macrophage Elastase); Matrix Metallopeptidase 12 (Macrophage Elastase); Macrophage Metalloelastase; Matrix Metalloproteinase-12; Macrophage Elastase

  • AA Sequence

    APMNDSEFAEWYLSRFYDYGKDRIPMTKTKTNRNFLKEKLQEMQQFFGLEATGQLDNSTLAIMHIPRCGVPDVQHLRAVPQRSRWMKRYLTYRIYNYTPDMKREDVDYIFQKAFQVWSDVTPLRFRKLHKDEADIMILFAFGAHGDFNYFDGKGGTLAHAFYPGPGIQGDAHFDEAETWTKSFQGTNLFLVAVHELGHSLGLQHSNNPKSIMYPTYRYLNPSTFRLSADDIRNIQSLYGAPVKPPSLTKPSSPPSTFCHQSLSFDAVTTVGEKIFFFKDWFFWWKLPGSPATNITSISSIWPSIPSGIQAAYEIESRNQLFLFKDEKYWLINNLVPEPHYPRSIYSLGFSASVKKVDAAVFDPLRQKVYFFVDKHYWRYDVRQELMDPAYPKLISTHFPGIKPKIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLKSTSWFGC

  • Predicted Molecular Mass

    53 kDa

  • Molecular Weight

    Approximately 64 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM PB, 500 mM NaCl, 0.01% Tween 80, 1 mM EDTA, 50% glycerol, pH 6.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • MMP-12 Protein, Mouse (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for MMP-12 Protein, Mouse (HEK293, His)
  • MMP-12 Protein, Mouse (HEK293, His) Product Image