1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Matrix Metalloproteinases
  4. MMP-12
  5. MMP-12 Protein, Human

MMP-12 protein is potentially engaged in tissue injury and remodeling, displaying significant elastolytic activity. It shows flexibility at the P1' site, accommodating both large and small amino acids, yet favoring leucine. At the P1 site, it prefers aromatic or hydrophobic residues, with a tendency for small hydrophobic residues like alanine in the P3 position. MMP-12 Protein, Human is the recombinant human-derived MMP-12 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
20 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MMP-12 protein is potentially engaged in tissue injury and remodeling, displaying significant elastolytic activity. It shows flexibility at the P1' site, accommodating both large and small amino acids, yet favoring leucine. At the P1 site, it prefers aromatic or hydrophobic residues, with a tendency for small hydrophobic residues like alanine in the P3 position. MMP-12 Protein, Human is the recombinant human-derived MMP-12 protein, expressed by E. coli , with tag free.

Background

The MMP-12 protein is potentially involved in tissue injury and remodeling and possesses notable elastolytic activity. It demonstrates the ability to accept both large and small amino acids at the P1' site, although it exhibits a preference for leucine. At the P1 site, it favors aromatic or hydrophobic residues, with a preference for small hydrophobic residues like alanine in the P3 position.

Biological Activity

Measured by its ability to cleave the fluorogenic peptide substrate, Mca-PLGL-Dpa-AR-NH2 and the specific activity is > 800 pmoles/min/µg.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P39900 (G106-N268)

Gene ID
Molecular Construction
N-term
MMP-12 (G106-N268)
Accession # P39900
C-term
Protein Length

Partial

Synonyms
Macrophage metalloelastase; MME; MMP-12; HME
AA Sequence

GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDFHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYGDPKEN

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 90%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 10 mM Hepes, 2 mM CaCl2, 250 mM NaCl, pH 7.0, 5% trehalose, 5% Mannitol, 0.01% Tween-80.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 2 mM CaCl2, 250 mM NaCl, pH 7, 5% trehalose, 5% Mannitol, 0.01% Tween-80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
3.Lyophilized from a 0.22 μm filtered solution of 10 mM Hepes, 2 mM CaCl2, 250 mM NaCl, pH 7.0, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MMP-12 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

MMP-12 Protein, Human

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MMP-12 Protein, Human
Cat. No.:
HY-P74744
Quantity:
MCE Japan Authorized Agent: