MMP-12 Protein, Human

Customer Review

Based on 1 Customer Validation

MMP-12 protein is potentially engaged in tissue injury and remodeling, displaying significant elastolytic activity. It shows flexibility at the P1' site, accommodating both large and small amino acids, yet favoring leucine. At the P1 site, it prefers aromatic or hydrophobic residues, with a tendency for small hydrophobic residues like alanine in the P3 position. MMP-12 Protein, Human is the recombinant human-derived MMP-12 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

MMP-12 protein is potentially engaged in tissue injury and remodeling, displaying significant elastolytic activity. It shows flexibility at the P1' site, accommodating both large and small amino acids, yet favoring leucine. At the P1 site, it prefers aromatic or hydrophobic residues, with a tendency for small hydrophobic residues like alanine in the P3 position. MMP-12 Protein, Human is the recombinant human-derived MMP-12 protein, expressed by E. coli , with tag free.

Background

The MMP-12 protein is potentially involved in tissue injury and remodeling and possesses notable elastolytic activity. It demonstrates the ability to accept both large and small amino acids at the P1' site, although it exhibits a preference for leucine. At the P1 site, it favors aromatic or hydrophobic residues, with a preference for small hydrophobic residues like alanine in the P3 position.

Verified Bioactivity

Measured by its ability to cleave the fluorogenic peptide substrate, Mca-PLGL-Dpa-AR-NH2 and the specific activity is > 800 pmoles/min/µg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • MMP-12 (G106-N268)
      Accession # P39900
    • C-term
  • Protein Length

    Partial

  • Synonyms

    MMP12; MMP-12; Matrix Metallopeptidase 12; MME; HME; ME; Matrix Metalloproteinase 12 (Macrophage Elastase); Matrix Metallopeptidase 12 (Macrophage Elastase); Macrophage Metalloelastase; Matrix Metalloproteinase-12; Macrophage Elastase

  • AA Sequence

    GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDFHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYGDPKEN

  • Molecular Weight

    Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of 10 mM Hepes, 2 mM CaCl2, 250 mM NaCl, pH 7.0, 5% trehalose, 5% Mannitol, 0.01% Tween-80.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 2 mM CaCl2, 250 mM NaCl, pH 7, 5% trehalose, 5% Mannitol, 0.01% Tween-80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
3.Lyophilized from a 0.22 μm filtered solution of 10 mM Hepes, 2 mM CaCl2, 250 mM NaCl, pH 7.0, 8% trehalose.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00