MMP-13 Protein, Human (HEK293)
Based on 1 publication(s) in Google Scholar
The MMP-13 protein plays a role in the degradation of extracellular matrix proteins, especially fibrillar collagen, fibronectin, TNC, and ACAN. It cleaves triple-helical collagen, preferentially cleaves type II collagen, and can also target other collagen types. MMP-13 Protein, Human (HEK293) is the recombinant human-derived MMP-13 protein, expressed by HEK293 , with tag free.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The MMP-13 protein plays a role in the degradation of extracellular matrix proteins, especially fibrillar collagen, fibronectin, TNC, and ACAN. It cleaves triple-helical collagen, preferentially cleaves type II collagen, and can also target other collagen types. MMP-13 Protein, Human (HEK293) is the recombinant human-derived MMP-13 protein, expressed by HEK293 , with tag free.
Background
MMP-13 (Matrix Metalloproteinase 13) emerges as a pivotal player in extracellular matrix modulation, wielding its influence over various proteins such as fibrillar collagen, fibronectin, TNC, and ACAN. It exhibits notable proficiency in cleaving triple helical collagens, particularly type I, type II, and type III, with the highest activity observed with soluble type II collagen. MMP-13's multifaceted role extends beyond matrix degradation; it may also act on key regulatory proteins, including TGFB1 and CCN2, thereby influencing processes such as wound healing, tissue remodeling, cartilage degradation, and bone development. Its indispensability in embryonic bone development and ossification underscores its significance, while its involvement in fracture healing through endochondral ossification highlights its dynamic contributions to physiological processes. Moreover, MMP-13 plays a role in keratinocyte migration during wound healing and is implicated in cell migration and tumor invasion, reflecting its diverse impact on cellular functions.
Verified Bioactivity
The enzymatic activity of MMP13 was measured using the FRET-based fluorescent substrate MOCAc-PLGL(Dpa)AR. After a 60-minute reaction, the fluorescence intensity generated in the system was positively correlated with the concentration of catalytically active MMP13.
Publications (1)
-
Journal Impact Factor
-
Most Recent
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
P45452 (L20-C471)
-
Gene ID4322
-
Molecular Construction
-
N-term
-
MMP-13 (L20-C471)
Accession # P45452 -
C-term
-
-
Protein Length
Full Length of Mature Protein (with propeptide)
-
Synonyms
MMP13; MMP-13; Matrix Metallopeptidase 13; Matrix Metalloproteinase 13; Collagenase 3; Alternative Protein MMP13; CLG3; MANDP1; Matrix Metalloproteinase 13 (Collagenase 3); MDST; Matrix Metalloproteinase-13
-
AA Sequence
LPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENAASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
-
Predicted Molecular Mass
52 kDa
-
Molecular Weight
Approximately 58 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 1 mM DTT, 200 mM NaCl, 20% glycerol.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (238 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
