MZB1/PERP1 Protein, Human (HEK293, His)
Based on 1 Customer Validation
MZB1/PERP1 protein binds to IgM heavy and light chains and helps IgM assembly and secretion. It acts as a molecular chaperone or oxidoreductase and exhibits low oxidoreductase activity. MZB1/PERP1 Protein, Human (HEK293, His) is the recombinant human-derived MZB1/PERP1 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
MZB1/PERP1 protein binds to IgM heavy and light chains and helps IgM assembly and secretion. It acts as a molecular chaperone or oxidoreductase and exhibits low oxidoreductase activity. MZB1/PERP1 Protein, Human (HEK293, His) is the recombinant human-derived MZB1/PERP1 protein, expressed by HEK293 , with C-His labeled tag.
Background
The MZB1/PERP1 Protein associates with immunoglobulin M (IgM) heavy and light chains, facilitating the assembly and secretion of IgM. Its influence may stem from its role as a molecular chaperone or an oxidoreductase, given its demonstrated low level of oxidoreductase activity (By similarity). Isoform 2 potentially participates in the regulation of apoptosis. Moreover, MZB1/PERP1 contributes to the diversification of peripheral B-cell functions by overseeing Ca(2+) stores, antibody secretion, and integrin activation. Acting as a hormone-regulated adipokine and pro-inflammatory cytokine, it is implicated in chronic inflammation, influencing cellular expansion and blunting insulin response in adipocytes. Additionally, MZB1/PERP1 may play a role in the onset of insulin resistance.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
Q8WU39-1 (D23-T185)
-
Molecular Construction
-
N-term
-
MZB1 (D23-T185)
Accession # Q8WU39-1 -
His
-
C-term
-
-
Protein Length
Full Length of Marginal zone B- and B1-cell-specific protein Chain
-
Synonyms
MZB1; Mesenteric Estrogen-Dependent Adipose 7; Marginal Zone B And B1 Cell Specific Protein; Plasma Cell-Induced Resident ER Protein; MEDA-7; Proapoptotic Caspase Adaptor Protein; PACAP; Proapoptotic Caspase Adapter Protein; PERp1; Plasma Cell-Induced ER
-
AA Sequence
DRAPLTATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRSCSRNWQDYGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSAT
-
Molecular Weight
Approximately 22 kDa & 20 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, PH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
