NDR1 Protein, Human (Active, sf9, GST)
NDR1 Protein, Human (Active, sf9, GST) is the recombinant human-derived NDR1, expressed by Sf9 insect cells , with GST labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
NDR1 Protein, Human (Active, sf9, GST) is the recombinant human-derived NDR1, expressed by Sf9 insect cells , with GST labeled tag.
Background
NDR1 is a serine/threonine-protein kinase that functions as a negative regulator of MAP3K1/2 signaling. It converts MAP3K2 from its phosphorylated form to the non-phosphorylated state and inhibits MAP3K2 autophosphorylation. Additionally, NDR1 acts as a ufmylation 'reader' in a kinase-independent manner by specifically recognizing and binding mono-ufmylated histone H4 during DNA damage response, facilitating the recruitment of SUV39H1 to double-strand breaks to activate ATM.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag GST
-
Accession
Q15208 (M1-K465)
-
Gene ID11329
-
Protein Length
Full Length
-
Synonyms
STK38; Nuclear Dbf2-Related Kinase 1; Serine/Threonine Kinase 38; NDR1 Protein Kinase; NDR1; Ndr Ser/Thr Kinase-Like Protein; NDR; Nuclear Dbf2-Related 1; Serine/Threonine-Protein Kinase 38
-
AA Sequence
MAMTGSTPCSSMSNHTKERVTMTKVTLENFYSNLIAQHEEREMRQKKLEKVMEEEGLKDEEKRLRRSAHARKETEFLRLKRTRLGLEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQDKLNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEFYRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAFSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYKKVMNWKETLTFPPEVPISEKAKDLILRFCCEWEHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILKPTVATSNHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK
-
Molecular Weight
Approximately 81 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
