Copy Link Print Information

Nectin-2/CD112 Protein, Rhesus Macaque (HEK293, His)

Customer Review

Based on 1 Customer Validation

Nectin-2, a poliovirus receptor-related 2 protein, is a type I transmembrane glycoprotein and a member of the Ig gene superfamily. Nectin-2, also known as CD112, is an adhesion molecule involved in the formation of cell junctions and interactions with other Nectin-family molecules. Nectin-2/CD112 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived Nectin-2/CD112 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rhesus Macaque
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Nectin-2/CD112 Protein, Rhesus Macaque (HEK293, His)
  • Experimental Validation Results for Nectin-2/CD112 Protein, Rhesus Macaque (HEK293, His)
  • Nectin-2/CD112 Protein, Rhesus Macaque (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

Nectin-2, a poliovirus receptor-related 2 protein, is a type I transmembrane glycoprotein and a member of the Ig gene superfamily. Nectin-2, also known as CD112, is an adhesion molecule involved in the formation of cell junctions and interactions with other Nectin-family molecules. Nectin-2/CD112 Protein, Rhesus Macaque (HEK293, His) is the recombinant Rhesus Macaque-derived Nectin-2/CD112 protein, expressed by HEK293 , with C-His labeled tag.

Background

Nectin-2, a poliovirus receptor-related 2 protein, is a type I transmembrane glycoprotein and a member of the Ig gene superfamily. Nectin-2, also known as CD112, is an adhesion molecule involved in the formation of cell junctions and interactions with other Nectin-family molecules. Nectin-2 enables cell adhesion molecule binding. Nectin-2 is involved in acrosome assembly, fusion of virus membrane with host plasma membrane and positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target[1][2].

Verified Bioactivity

Measured by its binding ability in a functional ELISA. When Recombinant Cynomolgus Nectin-2/CD112 is immobilized at 0.5 µg/mL (100 µL/well), Recombinant Cynomolgus DNAM-1/CD226 binds with an ED50 of 0.5776 μg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. When Recombinant Cynomolgus Nectin-2/CD112 is immobilized at 0.5 µg/mL (100 µL/well), Recombinant Cynomolgus DNAM-1/CD226 binds with an ED50 of 0.5776 μg/mL.

Technical Parameters

  • Species Rhesus Macaque
  • Source HEK293
  • Tag C-His
  • Accession

    Q0MSE5/NP_001037058.1 (Q32-L360)

  • Gene ID
    713229  [NCBI]
  • Molecular Construction
    • N-term
    • CD112 (Q32-L360)
      Accession # Q0MSE5/NP_001037058.1
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    NECTIN2; Poliovirus Receptor-Related 2 (Herpesvirus Entry Mediator B); Prev. PVRL2; Herpes Virus Entry Mediator B; Prev. HVEB; Herpesvirus Entry Mediator B; Nectin-2; Herpesvirus Entry Protein B; PRR2; Poliovirus Receptor-Like 2; PVRR2; CD112 Antigen; CD1

  • AA Sequence

    QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPPDHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTRQDTEAELQDATLALRGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPQNHAEAQEVTFSQDPVPVARCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVHSNPEPTGYDWSTTSGIFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPRASPRDMGPL

  • Molecular Weight

    Approximately 47 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. When Recombinant Cynomolgus Nectin-2/CD112 is immobilized at 0.5 µg/mL (100 µL/well), Recombinant Cynomolgus DNAM-1/CD226 binds with an ED50 of 0.5776 μg/mL.

  • Nectin-2/CD112 Protein, Rhesus Macaque (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for Nectin-2/CD112 Protein, Rhesus Macaque (HEK293, His)
  • Experimental Validation Results for Nectin-2/CD112 Protein, Rhesus Macaque (HEK293, His)
  • Nectin-2/CD112 Protein, Rhesus Macaque (HEK293, His) Product Image