1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins Other Kinases
  4. NEK
  5. NEK6
  6. NEK6 Protein, Human (Active, sf9, GST)

The NEK6 protein is a key kinase essential for driving mitotic cell cycle progression, ensuring chromosome segregation, robust spindle formation, and cytokinesis. It phosphorylates ATF4, CIR1, PTN, RAD26L, RBBP6, RPS7, RPS6KB1, TRIP4, STAT3 and histone H1/H3, affecting a variety of cellular processes. NEK6 Protein, Human (sf9, GST) is the recombinant human-derived NEK6 protein, expressed by sf9 insect cells , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
50 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The NEK6 protein is a key kinase essential for driving mitotic cell cycle progression, ensuring chromosome segregation, robust spindle formation, and cytokinesis. It phosphorylates ATF4, CIR1, PTN, RAD26L, RBBP6, RPS7, RPS6KB1, TRIP4, STAT3 and histone H1/H3, affecting a variety of cellular processes. NEK6 Protein, Human (sf9, GST) is the recombinant human-derived NEK6 protein, expressed by sf9 insect cells , with N-GST labeled tag.

Background

NEK6 protein, a pivotal kinase, assumes a crucial role in driving mitotic cell cycle progression with indispensable functions in chromosome segregation at the metaphase-anaphase transition, robust mitotic spindle formation, and cytokinesis. Its substrate spectrum includes ATF4, CIR1, PTN, RAD26L, RBBP6, RPS7, RPS6KB1, TRIP4, STAT3, and histones H1 and H3, reflecting its versatile impact on various cellular processes. NEK6's phosphorylation of KIF11 promotes mitotic spindle formation, and it actively participates in G2/M phase cell cycle arrest induced by DNA damage. Inhibition of NEK6 activity leads to apoptosis, underlining its essential role in cell survival. Intriguingly, NEK6 may contribute to tumorigenesis by suppressing p53/TP53-induced cancer cell senescence. Moreover, its phosphorylation of EML4 at 'Ser-144' promotes dissociation from microtubules during mitosis, a critical step for efficient chromosome congression. NEK6's multifaceted functions underscore its significance in orchestrating key events during mitotic progression and its potential implications in cancer-related processes.

Species

Human

Source

Sf9 insect cells

Tag

N-GST

Accession

Q9HC98 (A2-T313)

Gene ID

10783

Molecular Construction
N-term
GST
NEK6 (A2-T313)
Accession # Q9HC98
C-term
Protein Length

Partial

Synonyms
NEK6; Serine/threonine-protein kinase Nek6; Never in mitosis A-related kinase 6; NimA-related protein kinase 6; Protein kinase SID6-1512
AA Sequence

AGQPGHMPHGGSSNNLCHTLGPVHPPDPQRHPNTLSFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVHQVAKQMHIWMSST

Purity

≥ 85%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 200 mM NaCl, 20% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

NEK6 Protein, Human (Active, sf9, GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
NEK6 Protein, Human (Active, sf9, GST)
Cat. No.:
HY-P701825
Quantity:
MCE Japan Authorized Agent: