NEK6 Protein, Human (Active, sf9, GST)
The NEK6 protein is a key kinase essential for driving mitotic cell cycle progression, ensuring chromosome segregation, robust spindle formation, and cytokinesis. It phosphorylates ATF4, CIR1, PTN, RAD26L, RBBP6, RPS7, RPS6KB1, TRIP4, STAT3 and histone H1/H3, affecting a variety of cellular processes. NEK6 Protein, Human (sf9, GST) is the recombinant human-derived NEK6 protein, expressed by sf9 insect cells , with N-GST labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The NEK6 protein is a key kinase essential for driving mitotic cell cycle progression, ensuring chromosome segregation, robust spindle formation, and cytokinesis. It phosphorylates ATF4, CIR1, PTN, RAD26L, RBBP6, RPS7, RPS6KB1, TRIP4, STAT3 and histone H1/H3, affecting a variety of cellular processes. NEK6 Protein, Human (sf9, GST) is the recombinant human-derived NEK6 protein, expressed by sf9 insect cells , with N-GST labeled tag.
Background
NEK6 protein, a pivotal kinase, assumes a crucial role in driving mitotic cell cycle progression with indispensable functions in chromosome segregation at the metaphase-anaphase transition, robust mitotic spindle formation, and cytokinesis. Its substrate spectrum includes ATF4, CIR1, PTN, RAD26L, RBBP6, RPS7, RPS6KB1, TRIP4, STAT3, and histones H1 and H3, reflecting its versatile impact on various cellular processes. NEK6's phosphorylation of KIF11 promotes mitotic spindle formation, and it actively participates in G2/M phase cell cycle arrest induced by DNA damage. Inhibition of NEK6 activity leads to apoptosis, underlining its essential role in cell survival. Intriguingly, NEK6 may contribute to tumorigenesis by suppressing p53/TP53-induced cancer cell senescence. Moreover, its phosphorylation of EML4 at 'Ser-144' promotes dissociation from microtubules during mitosis, a critical step for efficient chromosome congression. NEK6's multifaceted functions underscore its significance in orchestrating key events during mitotic progression and its potential implications in cancer-related processes.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-GST
-
Accession
Q9HC98 (A2-T313)
-
Gene ID10783
-
Molecular Construction
-
N-term
-
GST
-
NEK6 (A2-T313)
Accession # Q9HC98 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
NEK6; Serine/Threonine-Protein Kinase Nek6; NIMA Related Kinase 6; Never In Mitosis A-Related Kinase 6; SID6-1512; NimA-Related Protein Kinase 6; NIMA (Never In Mitosis Gene A)-Related Kinase 6; Protein Kinase SID6-1512; Putative Serine-Threonine Protein
-
AA Sequence
AGQPGHMPHGGSSNNLCHTLGPVHPPDPQRHPNTLSFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVHQVAKQMHIWMSST
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
