NPDC-1 Protein, Human (HEK293, His)

NPDC-1 protein critically hinders oncogenic transformation in neural and non-neural cells, suppressing neural cell proliferation. Its multifaceted impact extends to transcriptional regulation, emphasizing its role as a regulator with implications for mitigating oncogenic processes and modulating cellular proliferation in diverse cell systems. NPDC-1 Protein, Human (HEK293, His) is the recombinant human-derived NPDC-1 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of NPDC-1 Protein, Human (HEK293, His) is 147 a.a., with molecular weight of 28-35 kDa.

The NPDC-1 protein exerts a critical role in impeding oncogenic transformation in both neural and non-neural cells while concurrently suppressing neural cell proliferation. Its potential involvement in transcriptional regulation further underscores its multifaceted impact. The nuanced function of NPDC-1 highlights its significance as a regulator, particularly in the context of mitigating oncogenic processes and modulating cellular proliferation, with implications for both neural and non-neural cell systems.

Human

HEK293

C-6*His

Q9NQX5 (G35-D181)

56654  [NCBI]

GHPDVAACPGSLDCALKRRARCPPGAHACGPCLQPFQEDQQGLCVPRMRRPPGGGRPQPRLEDEIDFLAQELARKESGHSTPPLPKDRQRLPEPATLGFSARGQGLELGLPSTPGTPTPTPHTSLGSPVSSDPVHMSPLEPRGGQGD

28-35 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris, 150 mM NaCl, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.