NPDC-1 Protein, Human (HEK293, His)
Based on 1 Customer Validation
NPDC-1 protein critically hinders oncogenic transformation in neural and non-neural cells, suppressing neural cell proliferation. Its multifaceted impact extends to transcriptional regulation, emphasizing its role as a regulator with implications for mitigating oncogenic processes and modulating cellular proliferation in diverse cell systems. NPDC-1 Protein, Human (HEK293, His) is the recombinant human-derived NPDC-1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
NPDC-1 protein critically hinders oncogenic transformation in neural and non-neural cells, suppressing neural cell proliferation. Its multifaceted impact extends to transcriptional regulation, emphasizing its role as a regulator with implications for mitigating oncogenic processes and modulating cellular proliferation in diverse cell systems. NPDC-1 Protein, Human (HEK293, His) is the recombinant human-derived NPDC-1 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
The NPDC-1 protein exerts a critical role in impeding oncogenic transformation in both neural and non-neural cells while concurrently suppressing neural cell proliferation. Its potential involvement in transcriptional regulation further underscores its multifaceted impact. The nuanced function of NPDC-1 highlights its significance as a regulator, particularly in the context of mitigating oncogenic processes and modulating cellular proliferation, with implications for both neural and non-neural cell systems.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q9NQX5 (G35-D181)
-
Molecular Construction
-
N-term
-
NPDC-1 (G35-D181)
Accession # Q9NQX5 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
NPDC1; DKFZp586J0523; Neural Proliferation, Differentiation And Control 1; NPDC-1; CAB-; CAB-1; CAB1; CAB; Neural Proliferation Differentiation And Control Protein 1
-
AA Sequence
GHPDVAACPGSLDCALKRRARCPPGAHACGPCLQPFQEDQQGLCVPRMRRPPGGGRPQPRLEDEIDFLAQELARKESGHSTPPLPKDRQRLPEPATLGFSARGQGLELGLPSTPGTPTPTPHTSLGSPVSSDPVHMSPLEPRGGQGD
-
Predicted Molecular Mass
16.5 kDa
-
Molecular Weight
Approximately 28-35 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (260 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
