glycoprotein D/gD Protein, HSV-1 (HEK293, His)
Based on 1 Customer Validation
glycoprotein D/gD Protein, HSV-1 (HEK293, His) is the recombinant virus-derived glycoprotein D/gD protein, expressed by HEK293, with C-6*His tag.
- Species: Virus
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
glycoprotein D/gD Protein, HSV-1 (HEK293, His) is the recombinant virus-derived glycoprotein D/gD protein, expressed by HEK293, with C-6*His tag.
Background
Envelope glycoprotein D (gD) plays a pivotal role in the viral life cycle by binding to potential host cell entry receptors, including TNFRSF14/HVEM and NECTIN1. Its interaction with these receptors may initiate fusion with the host membrane, a crucial step facilitated by the recruitment of the fusion machinery composed of gB and gH/gL. Existing as a homodimer, gD engages in various interactions with host receptors, such as TNFRSF14 and NECTINs, contributing to the intricate process of viral entry. Notably, gD forms associations with both gB and the gH/gL heterodimer, essential components of the fusion complex, highlighting its multifaceted role in the viral entry process. Additionally, gD interacts with the UL11 tegument protein, further emphasizing its involvement in the intricate interplay of viral proteins during infection.
Verified Bioactivity
Immobilized HSV Glycoprotein D Antibody at 2 μg/mL (100 μL/well) can bind Recombinant HSV-1 Envelope Glycoprotein D. The ED50 of Recombinant HSV-1 Envelope Glycoprotein D is 30-70 ng/mL.
Technical Parameters
-
Species Virus
-
Source HEK293
-
Tag C-6*His
-
Accession
YP_009137141 (K26-Y331)
-
Gene ID/
-
Molecular Construction
-
N-term
-
(M1-Y394)
Accession # YP_009137141 -
6*His
-
C-term
-
-
Protein Length
Partial Virion surface Domain
-
Synonyms
PAEP; PP14 Protein (Placental Protein 14); Progestagen Associated Endometrial Protein; Zona-Binding Inhibitory Factor-1; Glycodelin; Alpha Uterine Protein; PP14; Placental Protein 14; PAEG; Glycodelin-A; GD; Glycodelin-S; Progesterone-Associated Endometri
-
AA Sequence
KYALVDASLKMADPNRFRGKDLPVLDQLTDPPGVRRVYHIQAGLPDPFQPPSLPITVYYAVLERACRSVLLNAPSEAPQIVRGASEDVRKQPYNLTIAWFRMGGNCAIPITVMEYTECSYNKSLGACPIRTQPRWNYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRAKGSCKYALPLRIPPSACLSPQAYQQGVTVDSIGMLPRFIPENQRTVAVYSLKIAGWHGPKAPYTSTLLPPELSETPNATQPELAPEDPEDSALLEDPVGTVAPQIPPNWHIPSIQDAATPY
-
Predicted Molecular Mass
34.7 kDa
-
Molecular Weight
Approximately 42-56 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.2 μm filtered solution of PBS, pH 7.4
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
