Nucleophosmin/Npm1 Protein, Human (293a.a, His, soultion)

Customer Review

Based on 1 Customer Validation

The nucleophosmin/Npm1 protein plays critical roles in ribosome biogenesis, centrosome duplication, protein chaperones, histone assembly, and cell proliferation. Npm1 is a key player in the cellular orchestra that promotes ribosome nuclear export, associates with nucleolar ribonucleoprotein structures, and interacts with single-stranded nucleic acids. Nucleophosmin/Npm1 Protein, Human (193a.a, His) is the recombinant human-derived Nucleophosmin/Npm1 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The nucleophosmin/Npm1 protein plays critical roles in ribosome biogenesis, centrosome duplication, protein chaperones, histone assembly, and cell proliferation. Npm1 is a key player in the cellular orchestra that promotes ribosome nuclear export, associates with nucleolar ribonucleoprotein structures, and interacts with single-stranded nucleic acids. Nucleophosmin/Npm1 Protein, Human (193a.a, His) is the recombinant human-derived Nucleophosmin/Npm1 protein, expressed by E. coli , with N-His labeled tag.

Background

Nucleophosmin/Npm1 protein stands at the crossroads of diverse cellular processes, orchestrating pivotal roles in ribosome biogenesis, centrosome duplication, protein chaperoning, histone assembly, and the intricate regulation of cell proliferation. This multifaceted protein emerges as a key player in the cellular orchestra, binding to ribosomes to facilitate their nuclear export, associating with nucleolar ribonucleoprotein structures, and interacting with single-stranded nucleic acids. Functioning as a chaperonin, Npm1 collaborates with core histones H3, H2B, and H4, and stimulates the endonuclease activity of APEX1 on double-stranded DNA while inhibiting its activity on single-stranded RNA. Beyond its involvement in nucleolar processes, Npm1 regulates centrosome and centriole duplication, counteracts apoptosis, and modulates the transcriptional activity of MYC target genes in conjunction with MYC. The intricate web of interactions involves partners such as NSUN2, SENP3, RPS10, NEK2, ROCK2, BRCA2, RPGR, CENPW, EIF2AK2/PKR, CEBPA, DDX31, NOP53, LRRC34, RRP1B, NPM3, ALKBH2, and TTF1, underscoring the complexity and versatility of Npm1 in cellular functions.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • Npm1 (E2-L294)
      Accession # P06748-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    NPM1; Numatrin; Nucleophosmin 1; B23; Nucleophosmin; Nucleophosmin (Nucleolar Phosphoprotein B23, Numatrin); NPM; Nucleophosmin/Nucleoplasmin Family, Member 1; Nucleolar Phosphoprotein B23; Testicular Tissue Protein Li 128; Nucleolar Protein NO38; Mutant

  • AA Sequence

    EDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

  • Predicted Molecular Mass

    34 kDa

  • Purity

    ≥ 85%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 30 mM HEPES, 2 mM EDTA, 0.001% Tween, 15% glycerol, pH 7.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00