Nucleophosmin/Npm1 Protein, Human (293a.a, His, soultion)
Based on 1 Customer Validation
The nucleophosmin/Npm1 protein plays critical roles in ribosome biogenesis, centrosome duplication, protein chaperones, histone assembly, and cell proliferation. Npm1 is a key player in the cellular orchestra that promotes ribosome nuclear export, associates with nucleolar ribonucleoprotein structures, and interacts with single-stranded nucleic acids. Nucleophosmin/Npm1 Protein, Human (193a.a, His) is the recombinant human-derived Nucleophosmin/Npm1 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The nucleophosmin/Npm1 protein plays critical roles in ribosome biogenesis, centrosome duplication, protein chaperones, histone assembly, and cell proliferation. Npm1 is a key player in the cellular orchestra that promotes ribosome nuclear export, associates with nucleolar ribonucleoprotein structures, and interacts with single-stranded nucleic acids. Nucleophosmin/Npm1 Protein, Human (193a.a, His) is the recombinant human-derived Nucleophosmin/Npm1 protein, expressed by E. coli , with N-His labeled tag.
Background
Nucleophosmin/Npm1 protein stands at the crossroads of diverse cellular processes, orchestrating pivotal roles in ribosome biogenesis, centrosome duplication, protein chaperoning, histone assembly, and the intricate regulation of cell proliferation. This multifaceted protein emerges as a key player in the cellular orchestra, binding to ribosomes to facilitate their nuclear export, associating with nucleolar ribonucleoprotein structures, and interacting with single-stranded nucleic acids. Functioning as a chaperonin, Npm1 collaborates with core histones H3, H2B, and H4, and stimulates the endonuclease activity of APEX1 on double-stranded DNA while inhibiting its activity on single-stranded RNA. Beyond its involvement in nucleolar processes, Npm1 regulates centrosome and centriole duplication, counteracts apoptosis, and modulates the transcriptional activity of MYC target genes in conjunction with MYC. The intricate web of interactions involves partners such as NSUN2, SENP3, RPS10, NEK2, ROCK2, BRCA2, RPGR, CENPW, EIF2AK2/PKR, CEBPA, DDX31, NOP53, LRRC34, RRP1B, NPM3, ALKBH2, and TTF1, underscoring the complexity and versatility of Npm1 in cellular functions.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
P06748-1 (E2-L294)
-
Molecular Construction
-
N-term
-
His
-
Npm1 (E2-L294)
Accession # P06748-1 -
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
NPM1; Numatrin; Nucleophosmin 1; B23; Nucleophosmin; Nucleophosmin (Nucleolar Phosphoprotein B23, Numatrin); NPM; Nucleophosmin/Nucleoplasmin Family, Member 1; Nucleolar Phosphoprotein B23; Testicular Tissue Protein Li 128; Nucleolar Protein NO38; Mutant
-
AA Sequence
EDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL
-
Predicted Molecular Mass
34 kDa
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 30 mM HEPES, 2 mM EDTA, 0.001% Tween, 15% glycerol, pH 7.0.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)