NUP210 Protein, Human (sf9, GST)
NUP210 Protein, a nucleoporin, crucially contributes to nuclear pore assembly, spacing, and structural integrity, ensuring proper nuclear pore function for molecular transport between the nucleus and cytoplasm. NUP210 forms dimers and potentially higher-order oligomers, highlighting its intricate role in nuclear pore architecture. NUP210 Protein, Human (sf9, GST) is the recombinant human-derived NUP210 protein, expressed by Sf9 insect cells , with N-GST labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
NUP210 Protein, a nucleoporin, crucially contributes to nuclear pore assembly, spacing, and structural integrity, ensuring proper nuclear pore function for molecular transport between the nucleus and cytoplasm. NUP210 forms dimers and potentially higher-order oligomers, highlighting its intricate role in nuclear pore architecture. NUP210 Protein, Human (sf9, GST) is the recombinant human-derived NUP210 protein, expressed by Sf9 insect cells , with N-GST labeled tag.
Background
NUP210 Protein, a nucleoporin, plays a crucial role in nuclear pore assembly and fusion, contributing to nuclear pore spacing and maintaining structural integrity. This protein is essential for the proper functioning of nuclear pores, which facilitate the transport of molecules between the nucleus and the cytoplasm. NUP210 is known to form dimers and possibly higher-order oligomers, emphasizing its role in the intricate architecture and function of nuclear pores within the cellular environment.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-GST
-
Accession
Q8TEM1-1 (L1837-H1887)
-
Molecular Construction
-
N-term
-
GST
-
NUP210 (L1837-H1887)
Accession # Q8TEM1-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
NUP210; Nuclear Pore Membrane Glycoprotein 210; Nucleoporin 210; Pore Membrane Protein Of 210 KDa; POM210; Nuclear Pore Protein Gp210; KIAA0906; Nucleoporin 210kDa; GP210; Nucleoporin Nup210; Nuclear Envelope Pore Membrane Protein POM 210; FLJ22389
-
AA Sequence
LAVPAALTPRASPGHSPHYFAASSPTSPNALPPARKASPPSGLWSPAYASH
-
Predicted Molecular Mass
31.7 kDa
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
