OX40/TNFRSF4 Protein, Mouse (Biotinylated, HEK293, His-Avi)
OX40 (TNFRSF4), is a receptor for OX40 Ligand. OX40 is preferentially expressed by T cells. OX40 can be activated by OX40 Ligand, thereby functioning as a T cell co-stimulatory molecule. The OX40-OX40 Ligand interaction promotes effector T-cell survival and effectively induces memory T-cell generation, as well as enhances the helper function of Tfh for B cells, and also promotes the differentiation and maturation of DCs. OX40/TNFRSF4 Protein, Mouse (Biotinylated, HEK293, His-Avi) is a recombinant biotinylated mouse OX40 (V20-P211) with C-terminal Avi and His tag, which is produced in HEK293.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
OX40 (TNFRSF4), is a receptor for OX40 Ligand. OX40 is preferentially expressed by T cells. OX40 can be activated by OX40 Ligand, thereby functioning as a T cell co-stimulatory molecule. The OX40-OX40 Ligand interaction promotes effector T-cell survival and effectively induces memory T-cell generation, as well as enhances the helper function of Tfh for B cells, and also promotes the differentiation and maturation of DCs[1][2]. OX40/TNFRSF4 Protein, Mouse (Biotinylated, HEK293, His-Avi) is a recombinant biotinylated mouse OX40 (V20-P211) with C-terminal Avi and His tag, which is produced in HEK293.
Background
OX40 (TNFRSF4), a member of TNFR superfamily, is a receptor for OX40 Ligand. OX40 is preferentially expressed by T cells, but also found in natural killer T cells, natural killer cells, neutrophils, and human airway smooth muscle cells. Mouse OX40 shares 90% aa sequence identity with rat. Mouse OX40 shares <30% aa sequence identity with human[1].
OX40 Ligand can activate OX40 and thereby functioning as a T cell co-stimulatory molecule. The OX40-OX40 Ligand interaction promotes effector T-cell survival and effectively induces memory T-cell generation, as well as enhances the helper function of Tfh for B cells, and also promotes the differentiation and maturation of DCs[1][2].
The interaction between OX40 Ligand with OX40 is essential for the generation of antigen-specific memory T cells, and induces host antitumor immunity[3]. But the over-upregulation of OX40 and OX40L may induce abnormal activation of Tfh cells and excessive production of autoantibodies, which leads to autoimmune disease[1]. For example, OX40 interacts with OX40 Ligand is critical for Th1 and Th2 responses in mice allergic inflammation[4].
In Vitro
OX4 increases expression of RANTES protein in HUVECs[5].
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-Avi;C-8*His
-
Accession
P47741 (V20-P211)
-
Molecular Construction
-
N-term
-
OX40 (V20-P211)
Accession # P47741 -
8*His-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Conjugation
Biotin
-
Conjugate Method
The single lysine residue in Avitag is biotinylated through an enzymatic reaction.
-
Synonyms
TNFRSF4; CD134 Antigen; Prev. TXGP1L; Tumor Necrosis Factor Receptor Superfamily, Member 4; Tumor Necrosis Factor Receptor Superfamily Member 4; Lymphoid Activation Antigene ACT35; OX40L Receptor; OX40 Cell Surface Antigen; ACT35; OX40 Homologue; CD134; A
-
AA Sequence
VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP
-
Predicted Molecular Mass
24.2 kDa
-
Molecular Weight
Approximately 48-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
References
[1]. Kaur D, et al. OX40/OX40 ligand interactions in T-cell regulation and asthma. Chest. 2012 Feb;141(2):494-499. [Content Brief]
[2]. Fu N, et al. The OX40/OX40L Axis Regulates T Follicular Helper Cell Differentiation: Implications for Autoimmune Diseases. Front Immunol. 2021 Jun 21;12:670637. [Content Brief]
[3]. Buglio D, et al. HDAC11 plays an essential role in regulating OX40 ligand expression in Hodgkin lymphoma. Blood. 2011 Mar 10;117(10):2910-7. [Content Brief]
[4]. Arestides RS, et al. Costimulatory molecule OX40L is critical for both Th1 and Th2 responses in allergic inflammation. Eur J Immunol. 2002 Oct;32(10):2874-80. [Content Brief]
[5]. Kotani A, et al. Signaling of gp34 (OX40 ligand) induces vascular endothelial cells to produce a CC chemokine RANTES/CCL5. Immunol Lett. 2002 Oct 21;84(1):1-7. [Content Brief]
[6]. Wu LY, et al. Recombinant OX40 attenuates neuronal apoptosis through OX40-OX40L/PI3K/AKT signaling pathway following subarachnoid hemorrhage in rats. Exp Neurol. 2020 Apr;326:113179. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
