p38 delta/MAPK13 Protein, Human (Active, sf9, GST)

The p38 delta/MAPK13 protein is an important serine/threonine kinase in the MAP kinase pathway. It coordinates cellular responses to stimuli such as cytokines or stress and directly activates the transcription factors ELK1 and ATF2. In this cascade, p38 MAPK (including MAPK13) each phosphorylates approximately 200 to 300 substrates. p38 delta/MAPK13 Protein, Human (sf9, GST) is the recombinant human-derived p38 delta/MAPK13 protein, expressed by Sf9 insect cells , with N-GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The p38 delta/MAPK13 protein is an important serine/threonine kinase in the MAP kinase pathway. It coordinates cellular responses to stimuli such as cytokines or stress and directly activates the transcription factors ELK1 and ATF2. In this cascade, p38 MAPK (including MAPK13) each phosphorylates approximately 200 to 300 substrates. p38 delta/MAPK13 Protein, Human (sf9, GST) is the recombinant human-derived p38 delta/MAPK13 protein, expressed by Sf9 insect cells , with N-GST labeled tag.

Background

p38 delta/MAPK13, a serine/threonine kinase and integral component of the MAP kinase signal transduction pathway, is among the four p38 MAPKs pivotal in orchestrating cellular responses triggered by extracellular stimuli like pro-inflammatory cytokines or physical stress, resulting in the direct activation of transcription factors such as ELK1 and ATF2. Operating within this cascade, p38 MAPKs phosphorylate an extensive array of proteins, estimated at approximately 200 to 300 substrates each, with MAPK13 representing one of the less studied isoforms. It targets downstream kinases like MAPKAPK2, activating them through phosphorylation to further impact additional substrates. MAPK13 plays a critical role in regulating protein translation by phosphorylating and inactivating EEF2K, contributing to cytoskeletal remodeling through the phosphorylation of MAPT and STMN1. Moreover, it mediates UV irradiation-induced up-regulation of the gene expression of CXCL14 and plays a vital role in the regulation of epidermal keratinocyte differentiation, apoptosis, and skin tumor development. In response to stress, MAPK13 phosphorylates the transcriptional activator MYB, leading to rapid MYB degradation via a proteasome-dependent pathway. Additionally, MAPK13 phosphorylates and down-regulates PRKD1 during the regulation of insulin secretion in pancreatic beta cells.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-GST
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • GST
    • p38δ (M1-L365)
      Accession # O15264-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    MAPK13; Stress-Activated Protein Kinase 4; Prev. PRKM13; MAP Kinase 13; SAPK4; MAPK 13; P38delta; MAPK-13; Mitogen-Activated Protein Kinase P38 Delta; Mitogen-Activated Protein Kinase 13; MAP Kinase P38 Delta

  • AA Sequence

    MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL

  • Predicted Molecular Mass

    68.4 kDa

  • Molecular Weight

    Approximately 64 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00