1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins CMGC
  4. MAPK Family MAPK
  5. Mitogen-Activated Protein Kinase 13 (p38 delta/MAPK13)
  6. p38 delta/MAPK13 Protein, Human (Active, sf9, GST)

p38 delta/MAPK13 Protein, Human (Active, sf9, GST)

Cat. No.: HY-P73334
Handling Instructions Technical Support

The p38 delta/MAPK13 protein is an important serine/threonine kinase in the MAP kinase pathway. It coordinates cellular responses to stimuli such as cytokines or stress and directly activates the transcription factors ELK1 and ATF2. In this cascade, p38 MAPK (including MAPK13) each phosphorylates approximately 200 to 300 substrates. p38 delta/MAPK13 Protein, Human (sf9, GST) is the recombinant human-derived p38 delta/MAPK13 protein, expressed by Sf9 insect cells , with N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The p38 delta/MAPK13 protein is an important serine/threonine kinase in the MAP kinase pathway. It coordinates cellular responses to stimuli such as cytokines or stress and directly activates the transcription factors ELK1 and ATF2. In this cascade, p38 MAPK (including MAPK13) each phosphorylates approximately 200 to 300 substrates. p38 delta/MAPK13 Protein, Human (sf9, GST) is the recombinant human-derived p38 delta/MAPK13 protein, expressed by Sf9 insect cells , with N-GST labeled tag.

Background

p38 delta/MAPK13, a serine/threonine kinase and integral component of the MAP kinase signal transduction pathway, is among the four p38 MAPKs pivotal in orchestrating cellular responses triggered by extracellular stimuli like pro-inflammatory cytokines or physical stress, resulting in the direct activation of transcription factors such as ELK1 and ATF2. Operating within this cascade, p38 MAPKs phosphorylate an extensive array of proteins, estimated at approximately 200 to 300 substrates each, with MAPK13 representing one of the less studied isoforms. It targets downstream kinases like MAPKAPK2, activating them through phosphorylation to further impact additional substrates. MAPK13 plays a critical role in regulating protein translation by phosphorylating and inactivating EEF2K, contributing to cytoskeletal remodeling through the phosphorylation of MAPT and STMN1. Moreover, it mediates UV irradiation-induced up-regulation of the gene expression of CXCL14 and plays a vital role in the regulation of epidermal keratinocyte differentiation, apoptosis, and skin tumor development. In response to stress, MAPK13 phosphorylates the transcriptional activator MYB, leading to rapid MYB degradation via a proteasome-dependent pathway. Additionally, MAPK13 phosphorylates and down-regulates PRKD1 during the regulation of insulin secretion in pancreatic beta cells.

Species

Human

Source

Sf9 insect cells

Tag

N-GST

Accession

O15264-1 (M1-L365)

Gene ID
Molecular Construction
N-term
GST
p38δ (M1-L365)
Accession # O15264-1
C-term
Protein Length

Full Length of Isoform-1

Synonyms
Mitogen-activated protein kinase 13; MAPK 13; PRKM13; SAPK4
AA Sequence

MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFYDFYLVMPFMQTDLQKIMGMEFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMTGYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL

Predicted Molecular Mass
68.4 kDa
Molecular Weight

Approximately 64 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

p38 delta/MAPK13 Protein, Human (Active, sf9, GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
p38 delta/MAPK13 Protein, Human (Active, sf9, GST)
Cat. No.:
HY-P73334
Quantity:
MCE Japan Authorized Agent: