PCSK9 Protein, Human (419a.a, HEK293, His)
The PCSK9 protein is an important regulator of plasma cholesterol homeostasis, affecting LDL receptor family members such as LDLR and VLDLR. It promotes their intracellular degradation and enhances hepatic LDLR degradation through non-proteolytic mechanisms. PCSK9 Protein, Human (419a.a, HEK293, His) is the recombinant human-derived PCSK9 protein, expressed by HEK293, with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The PCSK9 protein is an important regulator of plasma cholesterol homeostasis, affecting LDL receptor family members such as LDLR and VLDLR. It promotes their intracellular degradation and enhances hepatic LDLR degradation through non-proteolytic mechanisms. PCSK9 Protein, Human (419a.a, HEK293, His) is the recombinant human-derived PCSK9 protein, expressed by HEK293, with C-His labeled tag.
Background
PCSK9 protein emerges as a pivotal regulator in the intricate orchestration of plasma cholesterol homeostasis. Demonstrating its influence on low-density lipid receptor family members, including the low-density lipoprotein receptor (LDLR), very low-density lipoprotein receptor (VLDLR), apolipoprotein E receptor (LRP1/APOER), and apolipoprotein receptor 2 (LRP8/APOER2), PCSK9 facilitates their degradation within intracellular acidic compartments. Employing a non-proteolytic mechanism, it enhances the hepatic LDLR degradation through a clathrin LDLRAP1/ARH-mediated pathway, possibly impeding LDLR recycling and directing it toward lysosomal degradation. Moreover, PCSK9 exhibits LDLR-independent inhibition of APOB intracellular degradation via the autophagosome/lysosome pathway and plays a role in the disposal of non-acetylated BACE1 intermediates in the early secretory pathway. Notably, it regulates epithelial Na(+) channel (ENaC)-mediated Na(+) absorption by augmenting ENaC proteasomal degradation, and influences neuronal apoptosis through the modulation of LRP8/APOER2 levels and associated anti-apoptotic signaling pathways.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
Q8NBP7-1 (Q31-H449)
-
Gene ID255738
-
Molecular Construction
-
N-term
-
PCSK9 (Q31-H449)
Accession # Q8NBP7-1 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
PCSK9; PC9; Prev. HCHOLA3; Hypercholesterolemia, Autosomal Dominant 3; NARC-1; Neural Apoptosis Regulated Convertase 1; Subtilisin/Kexin-Like Protease PC9; Neural Apoptosis-Regulated Convertase 1; FH3; LDLCQ1; Proprotein Convertase 9; FHCL3; NARC1; Propro
-
AA Sequence
QEDEDGDYEELVLALRSEEDGLAEAPEHGTTATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQSIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTH
-
Predicted Molecular Mass
13.8 kDa & 33.5 kDa
-
Molecular Weight
Approximately 15 kDa & 33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
