PCSK9 Protein, Human (419a.a, HEK293, His)

The PCSK9 protein is an important regulator of plasma cholesterol homeostasis, affecting LDL receptor family members such as LDLR and VLDLR. It promotes their intracellular degradation and enhances hepatic LDLR degradation through non-proteolytic mechanisms. PCSK9 Protein, Human (419a.a, HEK293, His) is the recombinant human-derived PCSK9 protein, expressed by HEK293, with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The PCSK9 protein is an important regulator of plasma cholesterol homeostasis, affecting LDL receptor family members such as LDLR and VLDLR. It promotes their intracellular degradation and enhances hepatic LDLR degradation through non-proteolytic mechanisms. PCSK9 Protein, Human (419a.a, HEK293, His) is the recombinant human-derived PCSK9 protein, expressed by HEK293, with C-His labeled tag.

Background

PCSK9 protein emerges as a pivotal regulator in the intricate orchestration of plasma cholesterol homeostasis. Demonstrating its influence on low-density lipid receptor family members, including the low-density lipoprotein receptor (LDLR), very low-density lipoprotein receptor (VLDLR), apolipoprotein E receptor (LRP1/APOER), and apolipoprotein receptor 2 (LRP8/APOER2), PCSK9 facilitates their degradation within intracellular acidic compartments. Employing a non-proteolytic mechanism, it enhances the hepatic LDLR degradation through a clathrin LDLRAP1/ARH-mediated pathway, possibly impeding LDLR recycling and directing it toward lysosomal degradation. Moreover, PCSK9 exhibits LDLR-independent inhibition of APOB intracellular degradation via the autophagosome/lysosome pathway and plays a role in the disposal of non-acetylated BACE1 intermediates in the early secretory pathway. Notably, it regulates epithelial Na(+) channel (ENaC)-mediated Na(+) absorption by augmenting ENaC proteasomal degradation, and influences neuronal apoptosis through the modulation of LRP8/APOER2 levels and associated anti-apoptotic signaling pathways.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • PCSK9 (Q31-H449)
      Accession # Q8NBP7-1
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    PCSK9; PC9; Prev. HCHOLA3; Hypercholesterolemia, Autosomal Dominant 3; NARC-1; Neural Apoptosis Regulated Convertase 1; Subtilisin/Kexin-Like Protease PC9; Neural Apoptosis-Regulated Convertase 1; FH3; LDLCQ1; Proprotein Convertase 9; FHCL3; NARC1; Propro

  • AA Sequence

    QEDEDGDYEELVLALRSEEDGLAEAPEHGTTATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQSIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTH

  • Predicted Molecular Mass

    13.8 kDa & 33.5 kDa

  • Molecular Weight

    Approximately 15 kDa & 33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00