1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. PCSK9 Protein, Human (419a.a, HEK293, His)

The PCSK9 protein is an important regulator of plasma cholesterol homeostasis, affecting LDL receptor family members such as LDLR and VLDLR. It promotes their intracellular degradation and enhances hepatic LDLR degradation through non-proteolytic mechanisms. PCSK9 Protein, Human (419a.a, HEK293, His) is the recombinant human-derived PCSK9 protein, expressed by HEK293, with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The PCSK9 protein is an important regulator of plasma cholesterol homeostasis, affecting LDL receptor family members such as LDLR and VLDLR. It promotes their intracellular degradation and enhances hepatic LDLR degradation through non-proteolytic mechanisms. PCSK9 Protein, Human (419a.a, HEK293, His) is the recombinant human-derived PCSK9 protein, expressed by HEK293, with C-His labeled tag.

Background

PCSK9 protein emerges as a pivotal regulator in the intricate orchestration of plasma cholesterol homeostasis. Demonstrating its influence on low-density lipid receptor family members, including the low-density lipoprotein receptor (LDLR), very low-density lipoprotein receptor (VLDLR), apolipoprotein E receptor (LRP1/APOER), and apolipoprotein receptor 2 (LRP8/APOER2), PCSK9 facilitates their degradation within intracellular acidic compartments. Employing a non-proteolytic mechanism, it enhances the hepatic LDLR degradation through a clathrin LDLRAP1/ARH-mediated pathway, possibly impeding LDLR recycling and directing it toward lysosomal degradation. Moreover, PCSK9 exhibits LDLR-independent inhibition of APOB intracellular degradation via the autophagosome/lysosome pathway and plays a role in the disposal of non-acetylated BACE1 intermediates in the early secretory pathway. Notably, it regulates epithelial Na(+) channel (ENaC)-mediated Na(+) absorption by augmenting ENaC proteasomal degradation, and influences neuronal apoptosis through the modulation of LRP8/APOER2 levels and associated anti-apoptotic signaling pathways.

Species

Human

Source

HEK293

Tag

C-His

Accession

Q8NBP7-1 (Q31-H449)

Gene ID

255738

Molecular Construction
N-term
PCSK9 (Q31-H449)
Accession # Q8NBP7-1
His
C-term
Protein Length

Partial

Synonyms
Proprotein Convertase Subtilisin/Kexin Type 9; Neural Apoptosis-Regulated Convertase 1; NARC-1; Proprotein Convertase 9; PC9; Subtilisin/Kexin-Like Protease PC9; PCSK9; NARC1
AA Sequence

QEDEDGDYEELVLALRSEEDGLAEAPEHGTTATFHRCAKDPWRLPGTYVVVLKEETHLSQSERTARRLQAQAARRGYLTKILHVFHGLLPGFLVKMSGDLLELALKLPHVDYIEEDSSVFAQSIPWNLERITPPRYRADEYQPPDGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFHRQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPPSTH

Predicted Molecular Mass
13.8 kDa & 33.5 kDa.
Molecular Weight

Approximately 15 kDa and 33 kDa, based on SDS-PAGE under non reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from 0.22 μm filtered solution of PBS, pH 7.4 with 10% trehalose as protectant.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PCSK9 Protein, Human (419a.a, HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PCSK9 Protein, Human (419a.a, HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PCSK9 Protein, Human (419a.a, HEK293, His)
Cat. No.:
HY-P704837
Quantity:
MCE Japan Authorized Agent: