PDRG1 Protein, Human (His)
Based on 1 Customer Validation
As a component of the PAQosome complex, the PDRG1 protein may play a role in chaperone-mediated protein folding. PAQosome is composed of multiple protein complexes, including PDRG1, and coordinates the biogenesis of multiple protein complexes. PDRG1 Protein, Human (His) is the recombinant human-derived PDRG1 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
As a component of the PAQosome complex, the PDRG1 protein may play a role in chaperone-mediated protein folding. PAQosome is composed of multiple protein complexes, including PDRG1, and coordinates the biogenesis of multiple protein complexes. PDRG1 Protein, Human (His) is the recombinant human-derived PDRG1 protein, expressed by E. coli , with N-His labeled tag.
Background
The PDRG1 protein is suggested to potentially play a role in chaperone-mediated protein folding. It is identified as a component of the PAQosome complex, responsible for the biogenesis of several protein complexes. The PAQosome consists of R2TP complex members RUVBL1, RUVBL2, RPAP3, and PIH1D1, along with URI complex members PFDN2, PFDN6, PDRG1, UXT, and URI1, as well as ASDURF, POLR2E, and DNAAF10/WDR92. The presence of PDRG1 in the PAQosome complex highlights its potential involvement in coordinating the assembly and maturation of various protein complexes, emphasizing its significance in cellular processes related to protein folding and complex biogenesis. The intricate composition of the PAQosome underscores the need for further investigation to elucidate the specific functions and molecular interactions of PDRG1 within this dynamic cellular complex.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q9NUG6 (M1-G133)
-
Molecular Construction
-
N-term
-
His
-
PDRG1 (M1-G133)
Accession # Q9NUG6 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
PDRG1; PDRG; Prev. C20orf126; Chromosome 20 Open Reading Frame 126; P53 And DNA Damage-Regulated Protein 1; P53 And DNA-Damage Regulated 1; DJ310O13.3; P53 And DNA Damage Regulated 1; Epididymis Secretory Sperm Binding Protein
-
AA Sequence
MLSPEAERVLRYLVEVEELAEEVLADKRQIVDLDTKRNQNREGLRALQKDLSLSEDVMVCFGNMFIKMPHPETKEMIEKDQDHLDKEIEKLRKQLKVKVNRLFEAQGKPELKGFNLNPLNQDELKALKVILKG
-
Molecular Weight
Approximately 12 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.5, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
