1. Recombinant Proteins
  2. Cytokines and Growth Factors Biotinylated Proteins
  3. Chemokine & Receptors
  4. CXC Chemokines
  5. Platelet Factor 4
  6. PF-4/CXCL4 Protein, Human (Biotinylated, His-Avi)

PF-4/CXCL4 Protein, Human (Biotinylated, His-Avi)

Cat. No.: HY-P700981
Handling Instructions Technical Support

Wnt-10b protein is a signaling molecule that plays a key role in embryonic development and tissue homeostasis. It is involved in regulating cell proliferation, differentiation and migration. PF-4/CXCL4 Protein, Human (Biotinylated, His-Avi) is the recombinant human-derived PF-4/CXCL4 protein, expressed by E. coli , with C-Avi, N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Wnt-10b protein is a signaling molecule that plays a key role in embryonic development and tissue homeostasis. It is involved in regulating cell proliferation, differentiation and migration. PF-4/CXCL4 Protein, Human (Biotinylated, His-Avi) is the recombinant human-derived PF-4/CXCL4 protein, expressed by E. coli , with C-Avi, N-His labeled tag.

Background

The PF-4/CXCL4 Protein, a member of the CXC chemokine family, is encoded by this gene. Released from the alpha granules of activated platelets in the form of a homotetramer, this chemokine exhibits high affinity for heparin and plays a crucial role in platelet aggregation. Beyond its involvement in platelet function, PF-4/CXCL4 is chemotactic for various cell types and serves as an inhibitor of hematopoiesis, angiogenesis, and T-cell function. Additionally, it demonstrates antimicrobial activity against Plasmodium falciparum. The gene displays biased expression, with elevated levels in the bone marrow (RPKM 14.3), spleen (RPKM 2.7), and one other tissue, underscoring its potential significance in various physiological contexts across multiple organs.

Biological Activity

Immobilized Human CCL5, His Tag at 5 μg/mL (100 μl/well) on the plate. Dose response curve for Biotinylated Human CXCL4, His Tag with the EC50 of 1.1 μg/mL determined by ELISA.

Species

Human

Source

E. coli

Tag

N-Avi;N-8*His

Accession

NP_002610.1 (E32-S101)

Gene ID
Molecular Construction
N-term
8*His-Avi
CXCL4 (E32-S101)
Accession # NP_002610.1
C-term
Protein Length

Full Length of Mature Protein

Conjugation

Biotin

Synonyms
PF-4; Oncostatin-A; CXCL4; SCYB4; Iroplact; MGC138298
AA Sequence

EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES

Predicted Molecular Mass
10.7 kDa
Molecular Weight

Approximately 13 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 4 mM HCl, pH 3.0, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in 4 mM HCl (pH 3.0).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

PF-4/CXCL4 Protein, Human (Biotinylated, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

PF-4/CXCL4 Protein, Human (Biotinylated, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
PF-4/CXCL4 Protein, Human (Biotinylated, His-Avi)
Cat. No.:
HY-P700981
Quantity:
MCE Japan Authorized Agent: