Plasminogen Protein, Human

Customer Review

Based on 1 Customer Validation

Plasminogen protein is the key precursor of plasmin and plays a central role in a variety of physiological and pathological processes. Plasmin is derived from plasminogen and dissolves fibrin during blood coagulation, affecting embryonic development, tissue remodeling, tumor invasion and inflammation. Plasminogen Protein, Human is the recombinant human-derived Plasminogen protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Plasminogen protein is the key precursor of plasmin and plays a central role in a variety of physiological and pathological processes. Plasmin is derived from plasminogen and dissolves fibrin during blood coagulation, affecting embryonic development, tissue remodeling, tumor invasion and inflammation. Plasminogen Protein, Human is the recombinant human-derived Plasminogen protein, expressed by E. coli , with tag free.

Background

Plasminogen Protein plays a crucial role in diverse physiological and pathological processes, functioning as the precursor to plasmin—a potent proteolytic factor with multifaceted activities. Plasmin's primary function involves the dissolution of fibrin in blood clots, contributing to processes such as embryonic development, tissue remodeling, tumor invasion, and inflammation. It weakens the walls of the Graafian follicle during ovulation and activates various enzymes, including urokinase-type plasminogen activator, collagenases, and complement zymogens such as C1 and C5. Plasmin's proteolytic action extends to cleaving fibronectin, laminin, fibrin, thrombospondin, and von Willebrand factor, resulting in cell detachment and apoptosis. Its involvement in tissue remodeling and tumor invasion may be modulated by CSPG4. Plasminogen also binds to cells, and the derived angiostatin serves as an angiogenesis inhibitor, blocking neovascularization and impeding the growth of experimental primary and metastatic tumors in vivo. The diverse roles of Plasminogen underscore its significance in orchestrating complex cellular and physiological processes.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human Plasminogen at 2 μg/mL can bind Anti-Plasminogen antibody. The ED50 for this effect is 10-50 ng/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Plasminogen (V98-P356)
      Accession # P00747
    • C-term
  • Protein Length

    Partial

  • Synonyms

    PLG; PLG Protein; Plasminogen; Plasmin; HCG2029799, Isoform CRA_d; HAE4; HCG2029799, Isoform CRA_b

  • AA Sequence

    VYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSP

  • Predicted Molecular Mass

    29.7 kDa

  • Molecular Weight

    Approximately 35 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM NaAc, 4 % Mannitol, pH 5.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00