Podoplanin Protein, Mouse (sf9, His)
Based on 1 Customer Validation
Podoplanin plays a crucial role in cell migration and adhesion by interacting with various partners. It promotes platelet activation and aggregation by binding to CLEC1B, but attenuates platelet aggregation and lung metastasis by interacting with CD9. Podoplanin Protein, Mouse (sf9, His) is the recombinant mouse-derived Podoplanin protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Mouse
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
Podoplanin plays a crucial role in cell migration and adhesion by interacting with various partners. It promotes platelet activation and aggregation by binding to CLEC1B, but attenuates platelet aggregation and lung metastasis by interacting with CD9. Podoplanin Protein, Mouse (sf9, His) is the recombinant mouse-derived Podoplanin protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
Podoplanin protein mediates diverse effects on cell migration and adhesion through its interactions with various partners. During development, it plays a crucial role in the separation of blood and lymphatic vessels by binding to CLEC1B, triggering CLEC1B activation in platelets and leading to platelet activation and/or aggregation. Conversely, interaction with CD9 attenuates platelet aggregation and pulmonary metastasis induced by Podoplanin. In cell migration and adhesion, Podoplanin exhibits multifaceted functions through interactions with MSN or EZR, promoting epithelial-mesenchymal transition, ERZ phosphorylation, and triggering RHOA activation, ultimately increasing cell migration and invasiveness. Binding with CD44 promotes directional cell migration in epithelial and tumor cells. In lymph nodes, Podoplanin controls fibroblastic reticular cells (FRCs) adhesion to the extracellular matrix and contraction of the actomyosin. Engagement of CLEC1B by Podoplanin in FRCs promotes relaxation by blocking lateral membrane interactions, leading to the reduction of ERM proteins and MYL9 activation. Additionally, Podoplanin interacts with LGALS8, possibly participating in connecting the lymphatic endothelium to the surrounding extracellular matrix. In keratinocytes, Podoplanin induces changes in cell morphology, including elongated shape, membrane protrusions, actin cytoskeleton reorganization, increased motility, and decreased cell adhesion. It also plays a role in controlling invadopodia stability and maturation in tumor cells, contributing to efficient degradation of the extracellular matrix. Podoplanin is required for normal lung cell proliferation and alveolus formation at birth, but it does not function as a water channel or a regulator of aquaporin-type water channels and has no effect on folic acid or amino acid transport. It forms homodimers and interacts with various proteins, including CLEC1B, CD9, LGALS8, HSPA9, CD44, MSN, EZR, and CCL21, each interaction contributing to different aspects of Podoplanin's multifaceted functions.
Verified Bioactivity
Measured by its ability to bind CLEC1B-His in a functional ELISA.
Technical Parameters
-
Species Mouse
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
Q62011 (M1-K133)
-
Molecular Construction
-
N-term
-
Podoplanin (M1-K133)
Accession # Q62011 -
His
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
PDPN; GP36; Podoplanin; T1A; Aggrus; Lung Type-I Cell Membrane-Associated Glycoprotein (T1A-2); PA2.26; Glycoprotein, 36-KD; T1A-2; HT1alpha-1; D2-40; HT1alpha-2; Gp38; HT1A-1; GP40; OTS8; Lung Type I Cell Membrane Associated Glycoprotein; T1A2; Glycoprot
-
AA Sequence
MWTVPVLFWVLGSVWFWDSAQGGTIGVNEDDIVTPGTGDGMVPPGIEDKITTTGATGGLNESTGKAPLVPTQRERGTKPPLEELSTSATSDHDHREHESTTTVKVVTSHSVDKKTSHPNRDNAGDETQTTDKK
-
Predicted Molecular Mass
13 kDa
-
Molecular Weight
Approximately 25 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.4, 10% Glycerol, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)