Podoplanin Protein, Mouse (sf9, His)

Customer Review

Based on 1 Customer Validation

Podoplanin plays a crucial role in cell migration and adhesion by interacting with various partners. It promotes platelet activation and aggregation by binding to CLEC1B, but attenuates platelet aggregation and lung metastasis by interacting with CD9. Podoplanin Protein, Mouse (sf9, His) is the recombinant mouse-derived Podoplanin protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: Sf9 insect cells
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Podoplanin plays a crucial role in cell migration and adhesion by interacting with various partners. It promotes platelet activation and aggregation by binding to CLEC1B, but attenuates platelet aggregation and lung metastasis by interacting with CD9. Podoplanin Protein, Mouse (sf9, His) is the recombinant mouse-derived Podoplanin protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

Podoplanin protein mediates diverse effects on cell migration and adhesion through its interactions with various partners. During development, it plays a crucial role in the separation of blood and lymphatic vessels by binding to CLEC1B, triggering CLEC1B activation in platelets and leading to platelet activation and/or aggregation. Conversely, interaction with CD9 attenuates platelet aggregation and pulmonary metastasis induced by Podoplanin. In cell migration and adhesion, Podoplanin exhibits multifaceted functions through interactions with MSN or EZR, promoting epithelial-mesenchymal transition, ERZ phosphorylation, and triggering RHOA activation, ultimately increasing cell migration and invasiveness. Binding with CD44 promotes directional cell migration in epithelial and tumor cells. In lymph nodes, Podoplanin controls fibroblastic reticular cells (FRCs) adhesion to the extracellular matrix and contraction of the actomyosin. Engagement of CLEC1B by Podoplanin in FRCs promotes relaxation by blocking lateral membrane interactions, leading to the reduction of ERM proteins and MYL9 activation. Additionally, Podoplanin interacts with LGALS8, possibly participating in connecting the lymphatic endothelium to the surrounding extracellular matrix. In keratinocytes, Podoplanin induces changes in cell morphology, including elongated shape, membrane protrusions, actin cytoskeleton reorganization, increased motility, and decreased cell adhesion. It also plays a role in controlling invadopodia stability and maturation in tumor cells, contributing to efficient degradation of the extracellular matrix. Podoplanin is required for normal lung cell proliferation and alveolus formation at birth, but it does not function as a water channel or a regulator of aquaporin-type water channels and has no effect on folic acid or amino acid transport. It forms homodimers and interacts with various proteins, including CLEC1B, CD9, LGALS8, HSPA9, CD44, MSN, EZR, and CCL21, each interaction contributing to different aspects of Podoplanin's multifaceted functions.

Verified Bioactivity

Measured by its ability to bind CLEC1B-His in a functional ELISA.

Technical Parameters

  • Species Mouse
  • Source Sf9 insect cells
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Podoplanin (M1-K133)
      Accession # Q62011
    • His
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    PDPN; GP36; Podoplanin; T1A; Aggrus; Lung Type-I Cell Membrane-Associated Glycoprotein (T1A-2); PA2.26; Glycoprotein, 36-KD; T1A-2; HT1alpha-1; D2-40; HT1alpha-2; Gp38; HT1A-1; GP40; OTS8; Lung Type I Cell Membrane Associated Glycoprotein; T1A2; Glycoprot

  • AA Sequence

    MWTVPVLFWVLGSVWFWDSAQGGTIGVNEDDIVTPGTGDGMVPPGIEDKITTTGATGGLNESTGKAPLVPTQRERGTKPPLEELSTSATSDHDHREHESTTTVKVVTSHSVDKKTSHPNRDNAGDETQTTDKK

  • Predicted Molecular Mass

    13 kDa

  • Molecular Weight

    Approximately 25 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.4, 10% Glycerol, 5% trehalose, 5% mannitol and 0.01% Tween 80.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00