Copy Link Print Information

PRDX5/Peroxiredoxin-5 Protein, Mouse (His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

The PRDX5/Peroxiredoxin-5 protein is a thiol-specific peroxidase that reduces hydrogen peroxide and organic hydroperoxides to water and alcohols. It plays a vital role in cellular protection from oxidative stress and detoxifying peroxides to maintain redox balance. PRDX5/Peroxiredoxin-5 Protein, Mouse (His) is the recombinant mouse-derived PRDX5/Peroxiredoxin-5 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for PRDX5/Peroxiredoxin-5 Protein, Mouse (His)
  • PRDX5/Peroxiredoxin-5 Protein, Mouse (His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download
Related Products:

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The PRDX5/Peroxiredoxin-5 protein is a thiol-specific peroxidase that reduces hydrogen peroxide and organic hydroperoxides to water and alcohols. It plays a vital role in cellular protection from oxidative stress and detoxifying peroxides to maintain redox balance. PRDX5/Peroxiredoxin-5 Protein, Mouse (His) is the recombinant mouse-derived PRDX5/Peroxiredoxin-5 protein, expressed by E. coli , with N-His labeled tag.

Background

PRDX5/Peroxiredoxin-5 Protein operates as a thiol-specific peroxidase, catalyzing the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. This protein plays a crucial role in cellular protection against oxidative stress by detoxifying various peroxides, showcasing its significance in maintaining cellular redox balance. Additionally, PRDX5 acts as a sensor of hydrogen peroxide-mediated signaling events, suggesting its involvement in modulating cellular responses to oxidative stress. The dual functionality of PRDX5 underscores its importance in cellular defense mechanisms and its potential contribution to regulatory pathways associated with redox signaling.

Verified Bioactivity

Measured by its ability to reduce H2O2 and the specific activity is ≥100 pmoles/min/μg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-His
  • Accession

    P99029-1 (M49-L210)

  • Gene ID
    54683  [NCBI]
  • Molecular Construction
    • N-term
    • His
    • PRDX5 (M49-L210)
      Accession # P99029-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    PRDX5; B166; Peroxiredoxin 5; Thioredoxin-Dependent Peroxiredoxin 5; AOEB166; Peroxiredoxin-5, Mitochondrial; ACR1; Alu Co-Repressor 1; PLP; Peroxiredoxin V; Peroxisomal Antioxidant Enzyme; MGC142285; Liver Tissue 2D-Page Spot 71B; MGC117264; Thioredoxin

  • AA Sequence

    MAPIKVGDAIPSVEVFEGEPGKKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAGALKAKGAQVVACLSVNDVFVIEEWGRAHQAEGKVRLLADPTGAFGKATDLLLDDSLVSLFGNRRLKRFSMVIDNGIVKALNVEPDGTGLTCSLAPNILSQL

  • Molecular Weight

    Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.5, 8% trehalose.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • PRDX5/Peroxiredoxin-5 Protein, Mouse (His) Product Image
    1/16
  • Experimental Validation Results for PRDX5/Peroxiredoxin-5 Protein, Mouse (His)
  • PRDX5/Peroxiredoxin-5 Protein, Mouse (His) Product Image