PRIM1 Protein, Human

Customer Review

Based on 1 Customer Validation

The PRIM1 protein is the catalytic subunit of the DNA primase complex and is essential for the initiation of DNA synthesis. PRIM1 Protein, Human is the recombinant human-derived PRIM1 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The PRIM1 protein is the catalytic subunit of the DNA primase complex and is essential for the initiation of DNA synthesis. PRIM1 Protein, Human is the recombinant human-derived PRIM1 protein, expressed by E. coli , with tag free.

Background

PRIM1, the catalytic subunit of the DNA primase complex and a vital component of the DNA polymerase alpha complex, plays a crucial role in the initiation of DNA synthesis. During the S phase of the cell cycle, the DNA polymerase alpha complex, comprising POLA1, POLA2, PRIM1, and PRIM2, is recruited to DNA replicative forks through direct interactions with MCM10 and WDHD1. Within this complex, PRIM1 initiates DNA synthesis by oligomerizing short RNA primers on both leading and lagging strands. The primers are subsequently extended by the polymerase alpha catalytic subunit and transferred to polymerase delta and polymerase epsilon for processive synthesis on the lagging and leading strands, respectively. In the primase complex, both subunits are indispensable for the initial di-nucleotide formation, while the extension of the primer depends solely on the catalytic subunit. PRIM1 synthesizes 9-mer RNA primers, known as 'unit length' RNA primers, incorporating ribonucleotides in the presence of ribo- and deoxy-nucleotide triphosphates (rNTPs, dNTPs). The initiation of RNA primer synthesis by PRIM1 requires a template thymine or cytidine, with an adenine or guanine at its 5'-end, and exhibits binding affinity for single-stranded DNA.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • PRIM1 (M1-F420)
      Accession # P49642
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    PRIM1; Primase Polypeptide 1, 49kDa; DNA Primase Subunit 1; DNA Primase Subunit 48; Primase, DNA, Polypeptide 1 (49kDa); Primase P49 Subunit; DNA Primase 49 KDa Subunit; DNA Primase AEP; DNA Primase Small Subunit; DNA Primase 1; Primase (DNA) Subunit 1; D

  • AA Sequence

    METFDPTELPELLKLYYRRLFPYSQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQKMNPYKIDIGAVYSHRPNQHNTVKLGAFQAQEKELVFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSGIVEYLSLVKGGQDVKKKVHLSEKIHPFIRKSINIIKKYFEEYALVNQDILENKESWDKILALVPETIHDELQQSFQKSHNSLQRWEHLKKVASRYQNNIKNDKYGPWLEWEIMLQYCFPRLDINVSKGINHLLKSPFSVHPKTGRISVPIDLQKVDQFDPFTVPTISFICRELDAISTNEEEKEENEAESDVKHRTRDYKKTSLAPYVKVFEHFLENLDKSRKGELLKKSDLQKDF

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM Tris-HCl, pH 7.5, 200 mM NaCl, 1 mM DTT, 5% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00