PVR/CD155 Protein, Human (Biotinylated, HEK293, His-Avi)

The PVR/CD155 protein plays a key role in initiating natural killer (NK) cell effector functions by binding to CD96 and CD226 receptors. These interactions form mature immune synapses that trigger adhesion, lytic granule secretion, interferon-γ (IFN-γ), and cytotoxicity of activated NK cells. PVR/CD155 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived PVR/CD155 protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

PVR/CD155 Protein assumes a pivotal role in orchestrating natural killer (NK) cell adhesion and initiating NK cell effector functions by binding to two distinct NK cell receptors, CD96 and CD226. These receptor interactions converge at the cell-cell contact site, culminating in the formation of a mature immunological synapse between the NK cell and the target cell. This event triggers adhesion, secretion of lytic granules, interferon-gamma (IFN-gamma), and activation of cytotoxicity in activated NK cells. PVR/CD155 may additionally facilitate NK cell-target cell modular exchange and PVR transfer to the NK cell, particularly crucial in tumor cells expressing high levels of PVR. In such instances, the transfer mechanism may induce fratricide NK cell activation, providing a mechanism for tumors to evade the immune response. Furthermore, PVR/CD155 is implicated in mediating tumor cell invasion and migration. In the context of microbial infection, the protein acts as a receptor for poliovirus and potentially plays a role in the axonal transport of the virus. This function involves targeting virion-PVR-containing endocytic vesicles to the microtubular network through interaction with DYNLT1, thereby facilitating axonal retrograde transport of the virus.

Measured by its binding ability in a functional ELISA. When immobilized Biotinylated Human CD155 His at 1 μg/mL (100μL/Well) on the streptavidin precoated plate (5 μg/mL), can bind Human TIGIT hFc Tag and the EC₅₀ is <10 ng/mL.

Human

HEK293

C-Avi;C-8*His

P15151-1 (W21-N343)

5817  [NCBI]

Extracellular Domain

Biotin

WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRN

55-70 kDa

≥ 95%, as determined by Bis-Tris PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.