1. Recombinant Proteins
  2. Enzymes & Regulators Kinases
  3. Transferases (EC 2) Serine/Threonine Kinase Proteins AGC
  4. DMPK
  5. ROCK1
  6. ROCK1 Protein, Human (Active, sf9, His)

The ROCK1 protein is a key kinase that regulates the actin cytoskeleton, cell polarity, smooth muscle contraction, and multiple cellular functions. It controls stress fibers, focal adhesion formation, neurite retraction, and cell motility by phosphorylating substrates such as DAPK3, GFAP, LIMK1, LIMK2, MYL9/MLC2, TPPP, PFN1, and PPP1R12A. ROCK1 Protein, Human (sf9, His) is the recombinant human-derived ROCK1 protein, expressed by sf9 insect cells , with N-8*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg Get quote
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The ROCK1 protein is a key kinase that regulates the actin cytoskeleton, cell polarity, smooth muscle contraction, and multiple cellular functions. It controls stress fibers, focal adhesion formation, neurite retraction, and cell motility by phosphorylating substrates such as DAPK3, GFAP, LIMK1, LIMK2, MYL9/MLC2, TPPP, PFN1, and PPP1R12A. ROCK1 Protein, Human (sf9, His) is the recombinant human-derived ROCK1 protein, expressed by sf9 insect cells , with N-8*His labeled tag.

Background

ROCK1 protein stands as a pivotal kinase, wielding key regulatory influence over the actin cytoskeleton and cellular polarity. Demonstrating a broad spectrum of cellular functions, ROCK1 intricately governs smooth muscle contraction, actin cytoskeleton organization, stress fiber and focal adhesion formation, neurite retraction, cell adhesion, and motility through the phosphorylation of diverse substrates such as DAPK3, GFAP, LIMK1, LIMK2, MYL9/MLC2, TPPP, PFN1, and PPP1R12A. It collaborates with FHOD1 to induce SRC-dependent non-apoptotic plasma membrane blebbing and phosphorylates JIP3, regulating the recruitment of JNK to JIP3 during UVB-induced stress. As a suppressor of inflammatory cell migration, ROCK1 influences PTEN phosphorylation and stability, while concurrently acting as a negative regulator of VEGF-induced angiogenic endothelial cell activation. Crucially involved in centrosome positioning and mitotic exit, ROCK1 plays roles in terminal erythroid differentiation, inhibition of podocyte motility, promotion of keratinocyte terminal differentiation, and facilitation of osteoblast compaction during matrix assembly, contributing to osteoblast mineralization. Moreover, ROCK1 may impact eyelid and ventral body wall closure through the induction of actomyosin bundle assembly. The diverse roles of ROCK1 underscore its multifaceted impact on cellular physiology and highlight its regulatory significance in various cellular processes.

Biological Activity

The activity was measured by off-chip mobility shift assay(MSA). The enzyme was incubated with fluorecence-labeled substrate and Mg(or Mn)/ATP. The phosphorylated and unphosphorylated substrates were separated and detected by MSA device. When the protein concentration is 1.56 nM, the conversion rate is about 27%.

Species

Human

Source

Sf9 insect cells

Tag

N-8*His

Accession

Q13464 (S6-R415)

Gene ID

6093

Molecular Construction
N-term
8*His
ROCK1 (S6-R415)
Accession # Q13464
C-term
Protein Length

Partial

Synonyms
ROCK1; Rho-associated protein kinase 1; Renal carcinoma antigen NY-REN-35; Rho-associated; coiled-coil-containing protein kinase 1; Rho-associated; coiled-coil-containing protein kinase I; ROCK-I; p160 ROCK-1; p160ROCK
AA Sequence

SFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYKDTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSNRRYLSSANPNDNR

Molecular Weight

50 kDa

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, 200 mM NaCl, 20% glycerol, 1 mM DTT. pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

ROCK1 Protein, Human (Active, sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ROCK1 Protein, Human (Active, sf9, His)
Cat. No.:
HY-P701770
Quantity:
MCE Japan Authorized Agent: