ROCK1 Protein, Human (Active, sf9, His)
Based on 1 Customer Validation
The ROCK1 protein is a key kinase that regulates the actin cytoskeleton, cell polarity, smooth muscle contraction, and multiple cellular functions. It controls stress fibers, focal adhesion formation, neurite retraction, and cell motility by phosphorylating substrates such as DAPK3, GFAP, LIMK1, LIMK2, MYL9/MLC2, TPPP, PFN1, and PPP1R12A. ROCK1 Protein, Human (sf9, His) is the recombinant human-derived ROCK1 protein, expressed by sf9 insect cells , with N-8*His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The ROCK1 protein is a key kinase that regulates the actin cytoskeleton, cell polarity, smooth muscle contraction, and multiple cellular functions. It controls stress fibers, focal adhesion formation, neurite retraction, and cell motility by phosphorylating substrates such as DAPK3, GFAP, LIMK1, LIMK2, MYL9/MLC2, TPPP, PFN1, and PPP1R12A. ROCK1 Protein, Human (sf9, His) is the recombinant human-derived ROCK1 protein, expressed by sf9 insect cells , with N-8*His labeled tag.
Background
ROCK1 protein stands as a pivotal kinase, wielding key regulatory influence over the actin cytoskeleton and cellular polarity. Demonstrating a broad spectrum of cellular functions, ROCK1 intricately governs smooth muscle contraction, actin cytoskeleton organization, stress fiber and focal adhesion formation, neurite retraction, cell adhesion, and motility through the phosphorylation of diverse substrates such as DAPK3, GFAP, LIMK1, LIMK2, MYL9/MLC2, TPPP, PFN1, and PPP1R12A. It collaborates with FHOD1 to induce SRC-dependent non-apoptotic plasma membrane blebbing and phosphorylates JIP3, regulating the recruitment of JNK to JIP3 during UVB-induced stress. As a suppressor of inflammatory cell migration, ROCK1 influences PTEN phosphorylation and stability, while concurrently acting as a negative regulator of VEGF-induced angiogenic endothelial cell activation. Crucially involved in centrosome positioning and mitotic exit, ROCK1 plays roles in terminal erythroid differentiation, inhibition of podocyte motility, promotion of keratinocyte terminal differentiation, and facilitation of osteoblast compaction during matrix assembly, contributing to osteoblast mineralization. Moreover, ROCK1 may impact eyelid and ventral body wall closure through the induction of actomyosin bundle assembly. The diverse roles of ROCK1 underscore its multifaceted impact on cellular physiology and highlight its regulatory significance in various cellular processes.
Verified Bioactivity
The activity was measured by off-chip mobility shift assay(MSA). The enzyme was incubated with fluorecence-labeled substrate and Mg(or Mn)/ATP. The phosphorylated and unphosphorylated substrates were separated and detected by MSA device. When the protein concentration is 1.56 nM, the conversion rate is about 27%.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-8*His
-
Accession
Q13464 (S6-R415)
-
Gene ID6093
-
Molecular Construction
-
N-term
-
8*His
-
ROCK1 (S6-R415)
Accession # Q13464 -
C-term
-
-
Protein Length
Partial
-
Synonyms
ROCK1; Rho-Associated, Coiled-Coil-Containing Protein Kinase 1; Rho Associated Coiled-Coil Containing Protein Kinase 1; Renal Carcinoma Antigen NY-REN-35; P160ROCK; ROCK-I; Rho-Associated Protein Kinase 1; Rho-Associated Protein Kinase; P160 ROCK-1; ROCK1
-
AA Sequence
SFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYKDTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFPDDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLSSDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSNRRYLSSANPNDNR
-
Predicted Molecular Mass
50 kDa
-
Molecular Weight
Approximately 50 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM HEPES, 200 mM NaCl, 20% glycerol, 1 mM DTT, pH 7.5.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (238 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)