1. Recombinant Proteins
  2. Others
  3. S100A1 Protein, Human

S100A1 is a small calcium-binding protein that plays critical roles in multiple processes, including Ca(2+) homeostasis and cardiomyocyte regulation. Elevated intracellular Ca(2+) triggers conformational changes in S100A1, thereby interacting with key proteins in cardiomyocytes such as RYR1, RYR2, ATP2A2 and F1-ATPase. S100A1 Protein, Human is the recombinant human-derived S100A1 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

S100A1 is a small calcium-binding protein that plays critical roles in multiple processes, including Ca(2+) homeostasis and cardiomyocyte regulation. Elevated intracellular Ca(2+) triggers conformational changes in S100A1, thereby interacting with key proteins in cardiomyocytes such as RYR1, RYR2, ATP2A2 and F1-ATPase. S100A1 Protein, Human is the recombinant human-derived S100A1 protein, expressed by E. coli , with tag free.

Background

S100A1 is a small calcium-binding protein that plays crucial roles in various biological processes, including Ca(2+) homeostasis, chondrocyte biology, and cardiomyocyte regulation. Upon an increase in intracellular Ca(2+) levels, S100A1 binds calcium, triggering conformational changes that facilitate interactions with specific target proteins, subsequently modulating their activity. Particularly, in cardiomyocytes, S100A1 orchestrates a network governing sarcoplasmic reticulum Ca(2+) cycling and mitochondrial function by interacting with key proteins such as ryanodine receptors RYR1 and RYR2, sarcoplasmic reticulum Ca(2+)-ATPase/ATP2A2, and mitochondrial F1-ATPase. This multifaceted protein also contributes to diastolic Ca(2+) dissociation and myofilament mechanics, enhancing relaxation during diastole. S100A1 exists as a dimer of either two alpha chains, two beta chains, or one of each, and it forms heterodimers with S100P. Additionally, it engages in various interactions with proteins like AGER, CAPZA1, FKBP4, RYR1, RYR2, CACYBP, PPP5C, ATP2A2, PLN, ATP5F1A, and ATP5F1B, participating in diverse cellular processes in a calcium-dependent manner.

Biological Activity

Measured by its binding ability in a functional ELISA.

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P23297 (M1-S94)

Gene ID
Molecular Construction
N-term
S100A1 (M1-S94)
Accession # P23297
C-term
Protein Length

Full Length

Synonyms
Protein S100-A1; S-100 protein alpha chain; S100A; S100A1; S100-alpha
AA Sequence

MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS

Predicted Molecular Mass
10.5 kDa
Molecular Weight

Approximately 9-10 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

S100A1 Protein, Human Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

S100A1 Protein, Human

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
S100A1 Protein, Human
Cat. No.:
HY-P74589
Quantity:
MCE Japan Authorized Agent: