S100A1 Protein, Human

Customer Review

Based on 1 Customer Validation

S100A1 is a small calcium-binding protein that plays critical roles in multiple processes, including Ca(2+) homeostasis and cardiomyocyte regulation. Elevated intracellular Ca(2+) triggers conformational changes in S100A1, thereby interacting with key proteins in cardiomyocytes such as RYR1, RYR2, ATP2A2 and F1-ATPase. S100A1 Protein, Human is the recombinant human-derived S100A1 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

S100A1 is a small calcium-binding protein that plays critical roles in multiple processes, including Ca(2+) homeostasis and cardiomyocyte regulation. Elevated intracellular Ca(2+) triggers conformational changes in S100A1, thereby interacting with key proteins in cardiomyocytes such as RYR1, RYR2, ATP2A2 and F1-ATPase. S100A1 Protein, Human is the recombinant human-derived S100A1 protein, expressed by E. coli , with tag free.

Background

S100A1 is a small calcium-binding protein that plays crucial roles in various biological processes, including Ca(2+) homeostasis, chondrocyte biology, and cardiomyocyte regulation. Upon an increase in intracellular Ca(2+) levels, S100A1 binds calcium, triggering conformational changes that facilitate interactions with specific target proteins, subsequently modulating their activity. Particularly, in cardiomyocytes, S100A1 orchestrates a network governing sarcoplasmic reticulum Ca(2+) cycling and mitochondrial function by interacting with key proteins such as ryanodine receptors RYR1 and RYR2, sarcoplasmic reticulum Ca(2+)-ATPase/ATP2A2, and mitochondrial F1-ATPase. This multifaceted protein also contributes to diastolic Ca(2+) dissociation and myofilament mechanics, enhancing relaxation during diastole. S100A1 exists as a dimer of either two alpha chains, two beta chains, or one of each, and it forms heterodimers with S100P. Additionally, it engages in various interactions with proteins like AGER, CAPZA1, FKBP4, RYR1, RYR2, CACYBP, PPP5C, ATP2A2, PLN, ATP5F1A, and ATP5F1B, participating in diverse cellular processes in a calcium-dependent manner.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized recombinant human Fc-S100B at 10 μg/mL (100 μl/well) can bind biotinylated human S100A1 with a linear range of 200-250 ng/mL.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • S100A1 (M1-S94)
      Accession # P23297
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    S100A1; Protein S100-A1; Prev. S100A; S100 Calcium-Binding Protein; S100-Alpha; Protein S100; S100 Calcium-Binding Protein A1; S100 Alpha; S-100 Protein Subunit Alpha; S100; S-100 Protein Alpha Chain; S100 Calcium Binding Protein A1; S100 Protein, Alpha P

  • AA Sequence

    MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS

  • Predicted Molecular Mass

    10.5 kDa

  • Molecular Weight

    Approximately 9-10 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00