SARS-CoV-2 S glycoprotein (V367F, HEK293, His)
SARS-CoV-2 S glycoprotein (V367F, HEK 293, His) is a SARS-CoV-2 S glycoprotein V367F protein with a His-flag. SARS-CoV-2 S glycoprotein (V367F) is a SARS-CoV-2 variant carrying the S protein amino acid (aa) change V367F. The mutant type V367F continuously circulating worldwide displays higher binding affinity to human ACE2 .
- Species: Virus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Description
SARS-CoV-2 S glycoprotein (V367F, HEK 293, His) is a SARS-CoV-2 S glycoprotein V367F protein with a His-flag. SARS-CoV-2 S glycoprotein (V367F) is a SARS-CoV-2 variant carrying the S protein amino acid (aa) change V367F. The mutant type V367F continuously circulating worldwide displays higher binding affinity to human ACE2 [1].
Background
SARS-CoV-2, causes the global pandemic coronavirus disease 2019 (Covid-19). SARS-CoV-2 belongs to a family of viruses known as coronaviruse. SARS-CoV-2 is the third human coronavirus this century known to cause pneumonia with a significant case-fatality rate. SARS-CoV-2 is comprised of four structural proteins: Spike protein (S protein), Envelope protein (E), Membrane protein (M), and Nucleocapsid protein (N). D614G does not alter S protein synthesis, processing, or incorporation into SARS-CoV-2 particles, but D614G affinity for ACE2 is reduced due to a faster dissociation rate[2][3].
Technical Parameters
-
Species Virus
-
Source HEK293
-
Tag C-10*His
-
Accession
P0DTC2 (R319-F541, V367F)
-
Molecular Construction
-
N-term
-
S glycoprotein (R319-F541, V367F)
Accession # P0DTC2 -
10*His
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
E2 Peplomer protein
-
AA Sequence
RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSFLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
-
Predicted Molecular Mass
27.9 kDa
-
Glycosylation
Yes
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
References
[1]. Junxian Ou, et al. V367F Mutation in SARS-CoV-2 Spike RBD Emerging during the Early Transmission Phase Enhances Viral Infectivity through Increased Human ACE2 Receptor Binding Affinity. J Virol. 2021 Jul 26;95(16):e0061721. [Content Brief]
[2]. Leonid Yurkovetskiy, et al. Structural and Functional Analysis of the D614G SARS-CoV-2 Spike Protein Variant. Cell. 2020 Oct 29;183(3):739-751.e8. [Content Brief]
[3]. Jessica A Plante, et al. Spike mutation D614G alters SARS-CoV-2 fitness. Nature. 2021 Apr;592(7852):116-121. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
