PEDF/Serpin F1 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

Serpin F1 protein, a neurotrophic factor, crucially promotes extensive neuronal differentiation in retinoblastoma cells and serves as a potent inhibitor of angiogenesis. Unlike active serpins, Serpin F1 does not undergo the typical S (stressed) to R (relaxed) conformational transition, lacking serine protease inhibitory activity. It also interacts with PNPLA2, enhancing the phospholipase A2 activity of PNPLA2. PEDF/Serpin F1 Protein, Human (HEK293, His) is the recombinant human-derived Serpin F1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Serpin F1 protein, a neurotrophic factor, crucially promotes extensive neuronal differentiation in retinoblastoma cells and serves as a potent inhibitor of angiogenesis. Unlike active serpins, Serpin F1 does not undergo the typical S (stressed) to R (relaxed) conformational transition, lacking serine protease inhibitory activity. It also interacts with PNPLA2, enhancing the phospholipase A2 activity of PNPLA2. PEDF/Serpin F1 Protein, Human (HEK293, His) is the recombinant human-derived Serpin F1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

Neurotrophic protein Serpin F1 plays a pivotal role in promoting extensive neuronal differentiation in retinoblastoma cells. Additionally, it functions as a potent inhibitor of angiogenesis. Notably, Serpin F1 does not undergo the S (stressed) to R (relaxed) conformational transition typical of active serpins, resulting in the absence of serine protease inhibitory activity. Furthermore, it interacts with PNPLA2, fostering the phospholipase A2 activity of PNPLA2.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Serpin F1 (Q20-P418)
      Accession # P36955
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    SERPINF1; Testis Tissue Sperm-Binding Protein Li 70n; Prev. PEDF; Serpin Peptidase Inhibitor, Clade F (Alpha-2 Antiplasmin, Pigment Epithelium Derived Factor), Member 1; EPC-1; Proliferation-Inducing Protein 35; Pigment Epithelium-Derived Factor; Serpin F

  • AA Sequence

    QNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGSMSIIFFLPLKVTQNLTLIEESLTSEFIHDIDRELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLFDSPDFSKITGKPIKLTQVEHRAGFEWNEDGAGTTPSPGLQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIGKILDPRGP

  • Predicted Molecular Mass

    45.4 kDa

  • Molecular Weight

    Approximately 50 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00