SHH Protein, Mouse
Based on 1 Customer Validation
SHH Protein, Mouse is a morphogenic factor that actively orchestrates many aspects of cerebellar development and maturation.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
SHH Protein, Mouse is a morphogenic factor that actively orchestrates many aspects of cerebellar development and maturation.
Sonic hedgehog (Shh) is a morphogenic factor that actively orchestrates many aspects of cerebellar development and maturation[1]. Sonic hedgehog (Shh) plays a critical role in post-natal skeletal muscle regeneration. Sonic hedgehog (Shh) is a crucial morphogen that regulates epithelial-mesenchymal interactions during embryogenesis. In adults, the Shh pathway has been shown to be up-regulated following skeletal muscle and myocardium ischemia, suggesting that the embryonic Shh pathway can be recruited[2].
The ED50 is <1 μg/mL as measured by C3H/10T1/2 (CCL-226) cells, corresponding to a specific activity of >1.0 × 103 units/mg.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
Q62226 (C25-G198, C25I-V-I)
-
Molecular Construction
-
N-term
-
SHH (C25-G198, C25I-V-I)
Accession # Q62226 -
C-term
-
-
Protein Length
Partial
-
Synonyms
SHH; Shh Unprocessed N-Terminal Signaling And C-Terminal Autoprocessing Domains; Prev. HLP3; Sonic Hedgehog Protein; Prev. HPE3; ShhNC; MCOPCB5; Sonic Hedgehog (Drosophila) Homolog; SMMCI; Sonic Hedgehog Homolog; TPTPS; Hedgehog Protein; HHG1; HHG-1; TPT;
-
AA Sequence
IVIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG
-
Predicted Molecular Mass
19.8 kDa
-
Molecular Weight
Approximately 20 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<0.2 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. De Luca A, et al. Sonic hedgehog patterning during cerebellar development. Cell Mol Life Sci. 2016 Jan; 73(2):291-303. [Content Brief]
[2]. Zeng Q, et al. Protective Effects of Sonic Hedgehog Against Ischemia/Reperfusion Injury in Mouse Skeletal Muscle via AKT/mTOR/p70S6K Signaling.Cell Physiol Biochem. 2017;43(5):1813-1828. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)