SIGIRR Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
SIGIRR protein negatively regulates the Toll-like pathway and IL-1R pathway by inhibiting the recruitment of TLR4.SIGIRR disrupts Il1R1 and IL1RAP heterodimerization through its extracellular domain.SIGIRR Protein, Mouse (HEK293, His-hFc) is the recombinant mouse-derived SIGIRR protein, expressed by HEK293 , with C-hFc, C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
SIGIRR protein negatively regulates the Toll-like pathway and IL-1R pathway by inhibiting the recruitment of TLR4.SIGIRR disrupts Il1R1 and IL1RAP heterodimerization through its extracellular domain.SIGIRR Protein, Mouse (HEK293, His-hFc) is the recombinant mouse-derived SIGIRR protein, expressed by HEK293 , with C-hFc, C-His labeled tag.
Background
SIGIRR Protein serves as a negative regulator within the Toll-like and IL-1R receptor signaling pathways, exerting its inhibitory effects by attenuating the recruitment of receptor-proximal signaling components to the TLR4 receptor, possibly through a TIR-TIR domain interaction with TLR4. Additionally, through its extracellular domain, SIGIRR interferes with the heterodimerization of Il1R1 and IL1RAP. The protein interacts with IL1R1, IRAK1, TLR4, TLR5, TLR9, and TRAF6, and upon IL-1 stimulation, it is found in a complex with IL1R1, SIGIRR, MYD88, IRAK1, and TRAF6. Moreover, upon stimulation with LPC, SIGIRR is part of a complex that includes TLR4, SIG1IR, MYD88, IRAK1, and TRAF6. It also interacts with PALM3, suggesting a multifaceted role in modulating inflammatory signaling pathways.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
Q9JLZ8 (M1-H117)
-
Molecular Construction
-
N-term
-
SIGIRR (M1-H117)
Accession # Q9JLZ8 -
hFc-His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
SIGIRR; Single Ig IL-1R-Related Molecule; Single Ig And TIR Domain Containing; Single Ig IL-1-Related Receptor; Toll/Interleukin-1 Receptor 8; IL-1R8; TIR8; Single Immunoglobulin And Toll-Interleukin 1 Receptor (TIR) Domain; Single Immunoglobulin Domain-C
-
AA Sequence
MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH
-
Predicted Molecular Mass
12.7 kDa
-
Molecular Weight
Approximately 20-40 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
