SIRT3 Protein, Human (His, SUMO)

Customer Review

Based on 1 Customer Validation

SIRT3 is an NAD-dependent protein deacetylase that dynamically affects the acetylation of mitochondrial target proteins, such as ACSS1, IDH, GDH, SOD2, PDHA1, LCAD, SDHA, and the ATP synthase subunit ATP5PO. Its deacetylation activity regulates cellular energy metabolism and fine-tunes tissue-specific ATP levels. SIRT3 Protein, Human (His, SUMO) is the recombinant human-derived SIRT3 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

SIRT3 is an NAD-dependent protein deacetylase that dynamically affects the acetylation of mitochondrial target proteins, such as ACSS1, IDH, GDH, SOD2, PDHA1, LCAD, SDHA, and the ATP synthase subunit ATP5PO. Its deacetylation activity regulates cellular energy metabolism and fine-tunes tissue-specific ATP levels. SIRT3 Protein, Human (His, SUMO) is the recombinant human-derived SIRT3 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag.

Background

SIRT3, a NAD-dependent protein deacetylase, intricately modulates the acetylation status of key lysine residues in various mitochondrial target proteins, including ACSS1, IDH, GDH, SOD2, PDHA1, LCAD, SDHA, and ATP synthase subunit ATP5PO. By catalyzing deacetylation, SIRT3 actively participates in the regulation of cellular energy metabolism, exerting influence on tissue-specific ATP levels and contributing to the fine-tuning of metabolic responses. Under metabolic stress conditions, SIRT3 deacetylates the transcription factor FOXO3, recruiting both FOXO3 and mitochondrial RNA polymerase POLRMT to mitochondrial DNA, thereby enhancing mtDNA transcription. Additionally, SIRT3 plays a crucial role in ceramide metabolism by deacetylating ceramide synthases CERS1, CERS2, and CERS6, promoting mitochondrial ceramide accumulation. Furthermore, SIRT3 regulates hepatic lipogenesis by utilizing NAD(+) substrate imported by SLC25A47, triggering downstream activation of the PRKAA1/AMPK-alpha signaling cascade. This activation ultimately leads to the downregulation of sterol regulatory element-binding protein (SREBP) transcriptional activities, mitigating ATP-consuming lipogenesis and restoring cellular energy balance.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His;N-SUMO
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His-SUMO
    • SIRT3 (S118-K399)
      Accession # Q9NTG7
    • C-term
  • Protein Length

    Partial

  • Synonyms

    SIRT3; Sirtuin (Silent Mating Type Information Regulation 2, S.Cerevisiae, Homolog) 3; Sirtuin 3; Mitochondrial Nicotinamide Adenine Dinucleotide-Dependent Deacetylase; SIR2L3; Silent Mating Type Information Regulation 2, S.Cerevisiae, Homolog 3; NAD-Depe

  • AA Sequence

    SDKGKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK

  • Predicted Molecular Mass

    44.4 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol,1 mM DTT.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00