SIRT4 Protein, Human (GST)

SIRT4 Protein, Human (GST) is the recombinant human-derived SIRT4, expressed by E. coli , with N-GST labeled tag. ,

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

SIRT4 Protein, Human (GST) is the recombinant human-derived SIRT4, expressed by E. coli , with N-GST labeled tag. ,

Background

SIRT4 functions as a NAD-dependent protein lipoamidase, biotinylase, deacetylase, and ADP-ribosyl transferase, with higher efficiency in removing lipoyl and biotinyl modifications than acetyl-lysine. It inhibits pyruvate dehydrogenase complex (PDH) activity by enzymatically hydrolyzing the lipoamide cofactor of DLAT in a phosphorylation-independent manner. SIRT4 also catalyzes ADP-ribosylation of target proteins like mitochondrial GLUD1, suppressing its enzymatic activity. As a negative regulator of mitochondrial glutamine metabolism, it mediates mono ADP-ribosylation of GLUD1 to inhibit anaplerosis, blocking glutamine entry into the tricarboxylic acid cycle and promoting cell cycle arrest. Its expression is repressed by mTORC1 signaling, enhancing anaplerosis and cell proliferation, while exhibiting tumor suppressor properties. Additionally, SIRT4 acts as a NAD-dependent protein deacetylase (by similar), deacetylating 'Lys-471' of MLYCD to regulate lipid homeostasis, though it does not deacetylate PC. It controls fatty acid oxidation by inhibiting PPARA transcriptional activation, likely via modulating NAD(+) levels to impair SIRT1-PPARA interaction, and downregulates insulin secretion.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-GST
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • GST
    • SIRT4 (S25-C314)
      Accession # Q9Y6E7
    • C-term
  • Protein Length

    Full Length of NAD-dependent protein lipoamidase sirtuin-4, mitochondrial Chain

  • Synonyms

    SIRT4; Regulatory Protein SIR2 Homolog 4; Sirtuin 4; SIR2-Like Protein 4; SIR2L4; Sirtuin (Silent Mating Type Information Regulation 2, S. Cerevisiae, Homolog) 4; NAD-Dependent Protein Lipoamidase Sirtuin-4, Mitochondrial; Sirtuin (Silent Mating Type Info

  • AA Sequence

    SKASIGLFVPASPPLDPEKVKELQRFITLSKRLLVMTGAGISTESGIPDYRSEKVGLYARTDRRPIQHGDFVRSAPIRQRYWARNFVGWPQFSSHQPNPAHWALSTWEKLGKLYWLVTQNVDALHTKAGSRRLTELHGCMDRVLCLDCGEQTPRGVLQERFQVLNPTWSAEAHGLAPDGDVFLSEEQVRSFQVPTCVQCGGHLKPDVVFFGDTVNPDKVDFVHKRVKEADSLLVVGSSLQVYSGYRFILTAWEKKLPIAILNIGPTRSDDLACLKLNSRCGELLPLIDPC

  • Predicted Molecular Mass

    60 kDa

  • Molecular Weight

    Approximately 60-65 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 80%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00