1. Recombinant Proteins
  2. Others
  3. Sorcin/SRI Protein, Human (sf9)

The Sorcin/SRI protein is a calcium-binding regulator that complexly regulates excitation-contraction coupling in the heart and plays a critical role in maintaining calcium homeostasis within the sarcoplasmic reticulum. As a homodimer, Sorcin/SRI affects the activity of the RYR2 calcium channel, helping to precisely control calcium dynamics in cardiomyocytes. Sorcin/SRI Protein, Human (sf9) is the recombinant human-derived Sorcin/SRI protein, expressed by Sf9 insect cells , with tag free.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 재고
50 μg   견적 받기  
100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

The Sorcin/SRI protein is a calcium-binding regulator that complexly regulates excitation-contraction coupling in the heart and plays a critical role in maintaining calcium homeostasis within the sarcoplasmic reticulum. As a homodimer, Sorcin/SRI affects the activity of the RYR2 calcium channel, helping to precisely control calcium dynamics in cardiomyocytes. Sorcin/SRI Protein, Human (sf9) is the recombinant human-derived Sorcin/SRI protein, expressed by Sf9 insect cells , with tag free.

Background

Sorcin (SRI) is a calcium-binding protein crucial for regulating excitation-contraction coupling in the heart, playing a significant role in maintaining calcium homeostasis within the sarcoplasmic reticulum. SRI has been identified as a modulator of RYR2 calcium channels, suggesting its involvement in finely tuning intracellular calcium dynamics. Existing as a homodimer, SRI also engages in protein-protein interactions, forming complexes with GCA, RYR2, and ANXA7. It has to underscore SRI's importance in modulating calcium signaling and excitation-contraction coupling in cardiac muscle, providing insights into its multifaceted role in cardiac physiology and its interactions with key regulatory proteins.

Species

Human

Source

Sf9 insect cells

Tag

Tag Free

Accession

P30626 (M1-V198)

Gene ID
Molecular Construction
N-term
SRI (M1-V198)
Accession # P30626
C-term
Protein Length

Full Length

Synonyms
22 kDa protein; CP22; V19
AA Sequence

MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV

Predicted Molecular Mass
21.8 kDa
분자량

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

각종 서류

Sorcin/SRI Protein, Human (sf9) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Sorcin/SRI Protein, Human (sf9)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Sorcin/SRI Protein, Human (sf9)
Cat. No.:
HY-P77210
수량:
MCE Japan Authorized Agent: