Sorcin/SRI Protein, Human (sf9)

The Sorcin/SRI protein is a calcium-binding regulator that complexly regulates excitation-contraction coupling in the heart and plays a critical role in maintaining calcium homeostasis within the sarcoplasmic reticulum. As a homodimer, Sorcin/SRI affects the activity of the RYR2 calcium channel, helping to precisely control calcium dynamics in cardiomyocytes. Sorcin/SRI Protein, Human (sf9) is the recombinant human-derived Sorcin/SRI protein, expressed by Sf9 insect cells , with tag free.

Sorcin (SRI) is a calcium-binding protein crucial for regulating excitation-contraction coupling in the heart, playing a significant role in maintaining calcium homeostasis within the sarcoplasmic reticulum. SRI has been identified as a modulator of RYR2 calcium channels, suggesting its involvement in finely tuning intracellular calcium dynamics. Existing as a homodimer, SRI also engages in protein-protein interactions, forming complexes with GCA, RYR2, and ANXA7. It has to underscore SRI's importance in modulating calcium signaling and excitation-contraction coupling in cardiac muscle, providing insights into its multifaceted role in cardiac physiology and its interactions with key regulatory proteins.

Human

Sf9 insect cells

Tag Free

P30626 (M1-V198)

6717  [NCBI]

Full Length

MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

≥ 90%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.